Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse FPN1/SLC40A1/Ferroportin Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JHI9
Molecular weight:
36.88 kDa

Original price was: $320.00.Current price is: $271.00.

50ug 15% OFF + 271 loyalty points
GST Thr230–Pro306 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse FPN1/SLC40A1/Ferroportin Protein, N-GST & C-His

Product name ARO-P16412-100
Uniprot ID Q9JHI9
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQEPTCASQMAEPFRTFRDGWVSYYNQP
Molecular weight 36.88 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr230-Pro306
Aliases /Synonyms Solute carrier family 40 member 1, Ferroportin-1, Iron-regulated transporter 1, Metal transporter protein 1, MTP1, Slc40a1, Fpn1, Ireg1, Slc11a3, Slc39a1
Reference ARO-P16412
Note For research use only.
Molecular Constructor
GST Thr230–Pro306 His
Product name ARO-P16412-1MG
Uniprot ID Q9JHI9
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQEPTCASQMAEPFRTFRDGWVSYYNQP
Molecular weight 36.88 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr230-Pro306
Aliases /Synonyms Solute carrier family 40 member 1, Ferroportin-1, Iron-regulated transporter 1, Metal transporter protein 1, MTP1, Slc40a1, Fpn1, Ireg1, Slc11a3, Slc39a1
Reference ARO-P16412
Note For research use only.
Molecular Constructor
GST Thr230–Pro306 His
Product name ARO-P16412-50
Uniprot ID Q9JHI9
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQEPTCASQMAEPFRTFRDGWVSYYNQP
Molecular weight 36.88 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr230-Pro306
Aliases /Synonyms Solute carrier family 40 member 1, Ferroportin-1, Iron-regulated transporter 1, Metal transporter protein 1, MTP1, Slc40a1, Fpn1, Ireg1, Slc11a3, Slc39a1
Reference ARO-P16412
Note For research use only.
Molecular Constructor
GST Thr230–Pro306 His

There are no reviews yet.

Be the first to review “Recombinant Mouse FPN1/SLC40A1/Ferroportin Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products