Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse GDF7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P43029
Molecular weight:
22.12 kDa

Original price was: $387.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
His86–Thr270
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse GDF7 Protein, N-His

Product name ARO-P10584-100
Uniprot ID P43029
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HFMMSLYRSLAGRAPVAAASGHGRVDTITGFTDQATQDETAAAEPGQSFLFDVSSLSEADEVVNAELRVLRRRSPEPDRDSATLLPRLLLSTCPDEAGTAHLLHSRAAEPLGGARWEAFDVTDAVQSHRRWPRASRKFCLVLRAVTASESSPLALRRLGFGWPGGGDGGGTAAEERALLVISSRT
Molecular weight 22.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His86-Thr270
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P10584
Note For research use only.
Molecular Constructor
His86–Thr270
Product name ARO-P10584-1MG
Uniprot ID P43029
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HFMMSLYRSLAGRAPVAAASGHGRVDTITGFTDQATQDETAAAEPGQSFLFDVSSLSEADEVVNAELRVLRRRSPEPDRDSATLLPRLLLSTCPDEAGTAHLLHSRAAEPLGGARWEAFDVTDAVQSHRRWPRASRKFCLVLRAVTASESSPLALRRLGFGWPGGGDGGGTAAEERALLVISSRT
Molecular weight 22.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His86-Thr270
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P10584
Note For research use only.
Molecular Constructor
His86–Thr270
Product name ARO-P10584-50
Uniprot ID P43029
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HFMMSLYRSLAGRAPVAAASGHGRVDTITGFTDQATQDETAAAEPGQSFLFDVSSLSEADEVVNAELRVLRRRSPEPDRDSATLLPRLLLSTCPDEAGTAHLLHSRAAEPLGGARWEAFDVTDAVQSHRRWPRASRKFCLVLRAVTASESSPLALRRLGFGWPGGGDGGGTAAEERALLVISSRT
Molecular weight 22.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His86-Thr270
Aliases /Synonyms Growth/differentiation factor 7, GDF-7, GDF7
Reference ARO-P10584
Note For research use only.
Molecular Constructor
His86–Thr270

Introduction to Recombinant Mouse GDF7 Protein

Recombinant Mouse GDF7 Protein is a type of protein that is produced through genetic engineering techniques. It is a member of the transforming growth factor beta (TGF-β) superfamily, which plays important roles in regulating cell growth, differentiation, and development. This protein is highly conserved among different species, and its structure and function have been extensively studied in both mice and humans.

Structure of Recombinant Mouse GDF7 Protein

Recombinant Mouse GDF7 Protein is a homodimer, meaning it is composed of two identical subunits. Each subunit consists of 120 amino acids and has a molecular weight of approximately 13.5 kDa. The protein has a characteristic cystine knot structure, with six cysteine residues forming three disulfide bonds that are essential for its stability and biological activity.

The crystal structure of Recombinant Mouse GDF7 Protein has been determined, revealing a compact globular domain with a central hydrophobic core and three protruding loops. These loops are important for binding to its receptor and other interacting proteins, and they also contribute to the structural stability of the protein.

Activity of Recombinant Mouse GDF7 Protein

Recombinant Mouse GDF7 Protein has been shown to have a variety of biological activities, including promoting bone formation, regulating cell proliferation and differentiation, and modulating immune responses. It exerts its effects by binding to specific cell surface receptors, such as activin receptor-like kinase (ALK) 4 and ALK5, and activating downstream signaling pathways.

One of the main functions of Recombinant Mouse GDF7 Protein is its role in bone formation and maintenance. It has been shown to stimulate the differentiation of mesenchymal stem cells into osteoblasts, which are responsible for bone formation. It also promotes the proliferation and survival of osteoblasts, leading to increased bone mass and strength. In addition, Recombinant Mouse GDF7 Protein has been found to inhibit the activity of osteoclasts, which are responsible for bone resorption, thus helping to maintain bone homeostasis.

Another important activity of Recombinant Mouse GDF7 Protein is its role in regulating cell proliferation and differentiation. It has been shown to inhibit the growth of certain tumor cells, indicating its potential as a therapeutic agent for cancer treatment. Additionally, Recombinant Mouse GDF7 Protein has been found to promote the differentiation of various cell types, including muscle cells, neuronal cells, and immune cells.

Application of Recombinant Mouse GDF7 Protein

Due to its diverse biological activities, Recombinant Mouse GDF7 Protein has a wide range of potential applications in both basic research and clinical settings. One of the main applications of this protein is in the study of bone formation and bone-related diseases. It can be used to investigate the mechanisms of bone development and regeneration, as well as to develop potential therapies for bone disorders such as osteoporosis and bone fractures.

Furthermore, Recombinant Mouse GDF7 Protein has potential applications in tissue engineering and regenerative medicine. Its ability to promote cell differentiation and tissue growth makes it a promising candidate for the development of new treatments for various diseases and injuries.

Finally, Recombinant Mouse GDF7 Protein has potential therapeutic applications in the treatment of various diseases, including cancer, musculoskeletal disorders, and immune-related disorders. Its ability to regulate cell growth and differentiation, as well as its anti-inflammatory properties, make it a promising candidate for the development of novel therapies.

Conclusion

In summary, Recombinant Mouse GDF7 Protein is a highly conserved protein with a characteristic cystine knot structure. It has diverse biological activities, including promoting bone formation, regulating cell proliferation and differentiation, and modulating immune responses. Its potential applications in various fields make it a

Recombinant Mouse GDF7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse GDF7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products