Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse Klrb1b Protein, N-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P27812
Molecular weight:
46.07 kDa

Original price was: $392.00.Current price is: $350.00.

50ug 11% OFF + 350 loyalty points
Fc Leu64–Ser223
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse Klrb1b Protein, N-Fc

Product name ARO-P15873-100
Uniprot ID P27812
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence LSVQKSSVQKICADVQENRTHTTDCSVNLECPQDWLSHRDKCFRVFQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGDTENGSCASISGDKVTSESCSTDNRWICQKELNHETPSNDS
Molecular weight 46.07 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu64-Ser223
Aliases /Synonyms Killer cell lectin-like receptor subfamily B member 1B allele A, CD161 antigen-like family member B, Lymphocyte antigen 55b, Ly-55b, NKR-P1 34, Natural killer cell surface protein NKR-P1B allele SJL/BALB, NKR-P1B, CD161b, Klrb1b, Ly55b, Nkrp1b
Reference ARO-P15873
Note For research use only.
Molecular Constructor
Fc Leu64–Ser223
Product name ARO-P15873-1MG
Uniprot ID P27812
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence LSVQKSSVQKICADVQENRTHTTDCSVNLECPQDWLSHRDKCFRVFQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGDTENGSCASISGDKVTSESCSTDNRWICQKELNHETPSNDS
Molecular weight 46.07 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu64-Ser223
Aliases /Synonyms Killer cell lectin-like receptor subfamily B member 1B allele A, CD161 antigen-like family member B, Lymphocyte antigen 55b, Ly-55b, NKR-P1 34, Natural killer cell surface protein NKR-P1B allele SJL/BALB, NKR-P1B, CD161b, Klrb1b, Ly55b, Nkrp1b
Reference ARO-P15873
Note For research use only.
Molecular Constructor
Fc Leu64–Ser223
Product name ARO-P15873-50
Uniprot ID P27812
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence LSVQKSSVQKICADVQENRTHTTDCSVNLECPQDWLSHRDKCFRVFQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGDTENGSCASISGDKVTSESCSTDNRWICQKELNHETPSNDS
Molecular weight 46.07 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu64-Ser223
Aliases /Synonyms Killer cell lectin-like receptor subfamily B member 1B allele A, CD161 antigen-like family member B, Lymphocyte antigen 55b, Ly-55b, NKR-P1 34, Natural killer cell surface protein NKR-P1B allele SJL/BALB, NKR-P1B, CD161b, Klrb1b, Ly55b, Nkrp1b
Reference ARO-P15873
Note For research use only.
Molecular Constructor
Fc Leu64–Ser223

There are no reviews yet.

Be the first to review “Recombinant Mouse Klrb1b Protein, N-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products