Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse RTN4R Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q99PI8
Molecular weight:
34.06 kDa

Original price was: $458.00.Current price is: $392.00.

100ug 14% OFF + 392 loyalty points
Thr25–Gly308
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse RTN4R Protein, N-His

Product name ARO-P11040-100
Uniprot ID Q99PI8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEG
Molecular weight 34.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr25-Gly308
Aliases /Synonyms NgR1, Rtn4r, Nogo receptor, Nogor, Ngr1, Nogo66 receptor-1, Nogo-66 receptor, Reticulon-4 receptor, NgR
Reference ARO-P11040
Note For research use only.
Molecular Constructor
Thr25–Gly308
Product name ARO-P11040-1MG
Uniprot ID Q99PI8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEG
Molecular weight 34.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr25-Gly308
Aliases /Synonyms NgR1, Rtn4r, Nogo receptor, Nogor, Ngr1, Nogo66 receptor-1, Nogo-66 receptor, Reticulon-4 receptor, NgR
Reference ARO-P11040
Note For research use only.
Molecular Constructor
Thr25–Gly308
Product name ARO-P11040-50
Uniprot ID Q99PI8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEG
Molecular weight 34.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr25-Gly308
Aliases /Synonyms NgR1, Rtn4r, Nogo receptor, Nogor, Ngr1, Nogo66 receptor-1, Nogo-66 receptor, Reticulon-4 receptor, NgR
Reference ARO-P11040
Note For research use only.
Molecular Constructor
Thr25–Gly308

Introduction

Recombinant Mouse RTN4R Protein, also known as Nogo receptor 1 (NgR1), is a transmembrane protein that plays a crucial role in the nervous system. It is encoded by the RTN4R gene and is highly expressed in the brain and spinal cord. This protein has been extensively studied due to its involvement in neural development, regeneration, and plasticity. In this article, we will provide a scientific description of the structure, activity, and application of Recombinant Mouse RTN4R Protein.

Structure of Recombinant Mouse RTN4R Protein

Recombinant Mouse RTN4R Protein is a 473 amino acid protein with a predicted molecular mass of 52 kDa. It consists of a short N-terminal cytoplasmic domain, a transmembrane region, and a large extracellular domain. The extracellular domain contains four leucine-rich repeat (LRR) motifs, which are involved in protein-protein interactions. The transmembrane region is responsible for anchoring the protein to the cell membrane, while the cytoplasmic domain is involved in signal transduction.

Activity of Recombinant Mouse RTN4R Protein

Recombinant Mouse RTN4R Protein is a receptor for three different ligands – Nogo, myelin-associated glycoprotein (MAG), and oligodendrocyte myelin glycoprotein (OMgp). These ligands are expressed in the central nervous system and are known to inhibit axonal growth and regeneration. The binding of these ligands to RTN4R initiates a signaling cascade that leads to the activation of RhoA, a small GTPase protein that regulates the actin cytoskeleton. This results in the collapse of growth cones and the inhibition of axonal growth.

Apart from its role in axonal growth inhibition, Recombinant Mouse RTN4R Protein also plays a critical role in synaptic plasticity. It has been shown to regulate the expression and localization of glutamate receptors, which are essential for synaptic transmission and plasticity. Additionally, RTN4R has been implicated in the regulation of neuronal survival and apoptosis.

Application of Recombinant Mouse RTN4R Protein

The activity of Recombinant Mouse RTN4R Protein in axonal growth inhibition and synaptic plasticity makes it a valuable tool for studying neural development and regeneration. Researchers have used this protein to investigate the molecular mechanisms underlying axonal growth inhibition and to develop strategies for promoting axonal regeneration after injury or disease. In addition, Recombinant Mouse RTN4R Protein has also been used to study the role of Nogo signaling in neurological disorders such as multiple sclerosis, Alzheimer’s disease, and spinal cord injury.

Moreover, Recombinant Mouse RTN4R Protein has potential therapeutic applications. In preclinical studies, blocking the activity of RTN4R has been shown to promote axonal regeneration and functional recovery after spinal cord injury. This has led to the development of drugs targeting RTN4R for the treatment of spinal cord injury and other neurological disorders.

Conclusion

Recombinant Mouse RTN4R Protein is a transmembrane protein that plays a critical role in axonal growth inhibition and synaptic plasticity. Its structure consists of a short cytoplasmic domain, a transmembrane region, and a large extracellular domain with LRR motifs. The binding of Nogo, MAG, and OMgp to RTN4R leads to the activation of RhoA and the inhibition of axonal growth. This protein has been extensively studied and has potential applications in neural development, regeneration, and therapy. Further research on Recombinant Mouse RTN4R Protein may provide valuable insights into the treatment of neurological disorders.

Recombinant Mouse RTN4R Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse RTN4R Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products