Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse TGFB1/TGF-beta-1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P04202
Molecular weight:
20.62 kDa

Original price was: $356.00.Current price is: $274.00.

50ug 23% OFF + 274 loyalty points
Lys106–Thr263
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse TGFB1/TGF-beta-1 Protein, N-His

Product name ARO-P10613-100
Uniprot ID P04202
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KEVTRVLMVDRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGISPKRRGDLGTIHDMNRPFLLLMAT
Molecular weight 20.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys106-Thr263
Aliases /Synonyms Transforming growth factor beta-1 proprotein, LAP, TGF-beta-1, TGFB1, TGFB
Reference ARO-P10613
Note For research use only.
Molecular Constructor
Lys106–Thr263
Product name ARO-P10613-1MG
Uniprot ID P04202
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KEVTRVLMVDRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGISPKRRGDLGTIHDMNRPFLLLMAT
Molecular weight 20.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys106-Thr263
Aliases /Synonyms Transforming growth factor beta-1 proprotein, LAP, TGF-beta-1, TGFB1, TGFB
Reference ARO-P10613
Note For research use only.
Molecular Constructor
Lys106–Thr263
Product name ARO-P10613-50
Uniprot ID P04202
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KEVTRVLMVDRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGISPKRRGDLGTIHDMNRPFLLLMAT
Molecular weight 20.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys106-Thr263
Aliases /Synonyms Transforming growth factor beta-1 proprotein, LAP, TGF-beta-1, TGFB1, TGFB
Reference ARO-P10613
Note For research use only.
Molecular Constructor
Lys106–Thr263

Introduction

Recombinant Mouse TGFB1, also known as TGF-beta-1, is a protein that plays a crucial role in various biological processes such as cell growth, differentiation, and immune response. This protein is produced through genetic engineering techniques, making it a recombinant protein. In this article, we will explore the structure, activity, and application of Recombinant Mouse TGFB1 in detail.

Structure of Recombinant Mouse TGFB1

Recombinant Mouse TGFB1 is a homodimeric protein consisting of two identical subunits of 112 amino acids each. Each subunit has a molecular weight of approximately 12.5 kDa. The overall structure of this protein is similar to other members of the transforming growth factor-beta (TGF-beta) superfamily, with a cysteine knot motif formed by six conserved cysteine residues.

The active form of Recombinant Mouse TGFB1 is a disulfide-linked homodimer, where the two subunits are held together by a disulfide bond between cysteine residues at positions 33 and 88. This structure is essential for the biological activity of the protein.

Activity of Recombinant Mouse TGFB1

Recombinant Mouse TGFB1 is a multifunctional cytokine that regulates a wide range of cellular processes. It exerts its effects by binding to specific cell surface receptors and activating downstream signaling pathways. The primary receptor for TGFB1 is the TGF-beta type II receptor (TGFBR2), which then recruits and phosphorylates the TGF-beta type I receptor (TGFBR1). This results in the activation of downstream signaling pathways, including the Smad pathway, which regulates gene expression.

One of the key activities of Recombinant Mouse TGFB1 is its ability to inhibit cell proliferation. This is achieved by inducing cell cycle arrest and promoting cell differentiation. Additionally, TGFB1 has been shown to play a role in wound healing, tissue repair, and immune response. It can also regulate the production and function of various immune cells, such as T cells, B cells, and macrophages.

Application of Recombinant Mouse TGFB1

Recombinant Mouse TGFB1 has a wide range of applications in both research and therapeutic settings. One of the primary uses of this protein is in cell culture experiments. It is commonly used to study the effects of TGFB1 on various cell types and to investigate its role in different biological processes.

In the field of regenerative medicine, Recombinant Mouse TGFB1 has shown promising results in promoting tissue repair and regeneration. It has been used in various preclinical studies to enhance wound healing and tissue regeneration in different organs, including skin, bone, and cartilage.

Furthermore, Recombinant Mouse TGFB1 has been studied for its potential therapeutic benefits in various diseases. Due to its ability to regulate immune responses, it has been investigated as a potential treatment for autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis. It has also shown promise in cancer therapy, as it can inhibit the growth and metastasis of certain types of cancers.

Conclusion

In summary, Recombinant Mouse TGFB1 is a vital protein with diverse functions in various biological processes. Its structure as a homodimer and its ability to activate downstream signaling pathways make it a potent regulator of cell growth and differentiation. Its applications in research and therapy make it a valuable tool in understanding and treating various diseases. With ongoing research and advancements in genetic engineering techniques, Recombinant Mouse TGFB1 holds great potential for future therapeutic applications.

Recombinant Mouse TGFB1/TGF-beta-1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse TGFB1/TGF-beta-1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products