Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse TIMP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P12032
Molecular weight:
21.98 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
His31–Arg205
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse TIMP1 Protein, N-His

Product name ARO-P10605-100
Uniprot ID P12032
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His31-Arg205
Aliases /Synonyms Erythroid-potentiating activity, TIMP, EPA, TIMP1, Metalloproteinase inhibitor 1, TIMP-1, Fibroblast collagenase inhibitor, Collagenase inhibitor, CLGI, Tissue inhibitor of metalloproteinases 1
Reference ARO-P10605
Note For research use only.
Molecular Constructor
His31–Arg205
Product name ARO-P10605-1MG
Uniprot ID P12032
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His31-Arg205
Aliases /Synonyms Erythroid-potentiating activity, TIMP, EPA, TIMP1, Metalloproteinase inhibitor 1, TIMP-1, Fibroblast collagenase inhibitor, Collagenase inhibitor, CLGI, Tissue inhibitor of metalloproteinases 1
Reference ARO-P10605
Note For research use only.
Molecular Constructor
His31–Arg205
Product name ARO-P10605-50
Uniprot ID P12032
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His31-Arg205
Aliases /Synonyms Erythroid-potentiating activity, TIMP, EPA, TIMP1, Metalloproteinase inhibitor 1, TIMP-1, Fibroblast collagenase inhibitor, Collagenase inhibitor, CLGI, Tissue inhibitor of metalloproteinases 1
Reference ARO-P10605
Note For research use only.
Molecular Constructor
His31–Arg205

Introduction:

Recombinant Mouse TIMP1 Protein is a synthetic form of the tissue inhibitor of metalloproteinase 1 (TIMP1) protein, which plays a crucial role in regulating the activity of matrix metalloproteinases (MMPs). This protein has been extensively studied for its structure, activity, and potential applications in various fields of research and medicine. In this article, we will explore the structure, activity, and applications of recombinant mouse TIMP1 protein.

Structure of Recombinant Mouse TIMP1 Protein:

Recombinant mouse TIMP1 protein is a 184 amino acid long protein with a molecular weight of approximately 21 kDa. It consists of a single polypeptide chain with a conserved N-terminal domain and a C-terminal domain. The N-terminal domain contains a cysteine residue, which is responsible for the binding of TIMP1 to metal ions, while the C-terminal domain is responsible for the inhibition of MMPs.

Activity of Recombinant Mouse TIMP1 Protein:

Recombinant mouse TIMP1 protein is a potent inhibitor of MMPs, which are enzymes that play a crucial role in the degradation of extracellular matrix (ECM) proteins. MMPs are involved in various physiological processes such as tissue remodeling, wound healing, and angiogenesis. However, their dysregulation has been linked to various pathological conditions, including cancer, arthritis, and cardiovascular diseases.

Recombinant mouse TIMP1 protein inhibits MMPs by binding to their catalytic site, thereby preventing their activity. It has been shown to inhibit a wide range of MMPs, including MMP-1, MMP-2, MMP-3, and MMP-9. This inhibition is reversible, and the protein can dissociate from the MMPs, allowing them to resume their activity.

Applications of Recombinant Mouse TIMP1 Protein:

Recombinant mouse TIMP1 protein has been extensively studied for its potential applications in various fields of research and medicine. Some of the major applications of this protein are discussed below:

1. Cancer Research:

MMPs play a crucial role in tumor invasion and metastasis by degrading the ECM and promoting angiogenesis. Recombinant mouse TIMP1 protein has been shown to inhibit the activity of MMPs, thereby suppressing tumor growth and metastasis. It has also been shown to sensitize cancer cells to chemotherapy and radiation therapy, making it a potential adjuvant therapy for cancer treatment.

2. Arthritis Research:

MMPs are known to play a significant role in the pathogenesis of arthritis by degrading the cartilage and promoting inflammation. Recombinant mouse TIMP1 protein has been shown to inhibit the activity of MMPs, thereby reducing cartilage degradation and inflammation in arthritis. It has also been shown to improve joint function and reduce pain in animal models of arthritis.

3. Cardiovascular Research:

MMPs are involved in the development of atherosclerosis, an inflammatory disease of the arteries. Recombinant mouse TIMP1 protein has been shown to inhibit the activity of MMPs, thereby reducing the progression of atherosclerosis. It has also been shown to improve cardiac function and reduce myocardial infarction in animal models of heart disease.

4. Tissue Engineering:

Recombinant mouse TIMP1 protein has been used in tissue engineering to control the degradation of ECM proteins and promote tissue regeneration. It has been shown to enhance the survival and function of transplanted cells, making it a potential therapeutic agent for tissue repair and regeneration.

Conclusion:

Recombinant mouse TIMP1 protein is a potent inhibitor of MMPs with a wide range of potential applications in research and medicine. Its structure, activity, and applications have been extensively studied, making it a valuable tool for understanding the role of MMPs in various physiological and pathological processes. Further research on this protein may lead to the development of novel therapeutic strategies for the treatment of various diseases.

Recombinant Mouse TIMP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse TIMP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products