Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse VSIG2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9Z109
Molecular weight:
24.15 kDa

Original price was: $370.00.Current price is: $327.00.

100ug 12% OFF + 327 loyalty points
Glu26–Ser234
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse VSIG2 Protein, N-His

Product name ARO-P10439-100
Uniprot ID Q9Z109
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVTVPTEPLSVPKGKTAELSCSYKTSVGDNFALEWSFVQPGKPISASVPVLYFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNWERLGSSPTPPPGSMVQDEVSGQLILTNLSLTSSGTYRCVASNQMGSASCELNLS
Molecular weight 24.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Ser234
Aliases /Synonyms V-set and immunoglobulin domain-containing protein 2, CT-like protein, VSIG2, Cortical thymocyte-like protein, CTH, CTXL
Reference ARO-P10439
Note For research use only.
Molecular Constructor
Glu26–Ser234
Product name ARO-P10439-1MG
Uniprot ID Q9Z109
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVTVPTEPLSVPKGKTAELSCSYKTSVGDNFALEWSFVQPGKPISASVPVLYFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNWERLGSSPTPPPGSMVQDEVSGQLILTNLSLTSSGTYRCVASNQMGSASCELNLS
Molecular weight 24.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Ser234
Aliases /Synonyms V-set and immunoglobulin domain-containing protein 2, CT-like protein, VSIG2, Cortical thymocyte-like protein, CTH, CTXL
Reference ARO-P10439
Note For research use only.
Molecular Constructor
Glu26–Ser234
Product name ARO-P10439-50
Uniprot ID Q9Z109
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EVTVPTEPLSVPKGKTAELSCSYKTSVGDNFALEWSFVQPGKPISASVPVLYFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTYLCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNWERLGSSPTPPPGSMVQDEVSGQLILTNLSLTSSGTYRCVASNQMGSASCELNLS
Molecular weight 24.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Ser234
Aliases /Synonyms V-set and immunoglobulin domain-containing protein 2, CT-like protein, VSIG2, Cortical thymocyte-like protein, CTH, CTXL
Reference ARO-P10439
Note For research use only.
Molecular Constructor
Glu26–Ser234

Introduction

Recombinant Mouse VSIG2 Protein is a synthetic form of the mouse V-set and immunoglobulin domain-containing protein 2 (VSIG2). This protein is commonly used in scientific research due to its unique structure and diverse range of activities. In this article, we will explore the structure, activity, and applications of Recombinant Mouse VSIG2 Protein.

Structure of Recombinant Mouse VSIG2 Protein

Recombinant Mouse VSIG2 Protein is a 45 kDa protein consisting of 402 amino acids. It contains a single V-set domain, an immunoglobulin-like domain, and a mucin-like domain. The V-set domain is responsible for protein-protein interactions, while the immunoglobulin-like domain is involved in binding to antigens. The mucin-like domain contains multiple glycosylation sites, which are important for protein stability and function.

Activity of Recombinant Mouse VSIG2 Protein

Recombinant Mouse VSIG2 Protein is a cell surface protein that is primarily expressed in immune cells, such as T cells, B cells, and dendritic cells. It has been shown to play a role in regulating immune responses and promoting immune tolerance. This is achieved through its ability to interact with various immune cells and modulate their activity.

One of the key activities of Recombinant Mouse VSIG2 Protein is its ability to bind to antigens. This binding can occur through the immunoglobulin-like domain, which has been shown to interact with a variety of antigens, including bacterial and viral proteins. This interaction can trigger immune responses, leading to the activation of immune cells and the production of antibodies.

Additionally, Recombinant Mouse VSIG2 Protein has been found to have immunosuppressive effects. It has been shown to inhibit the proliferation and activation of T cells, as well as the production of pro-inflammatory cytokines. This activity is important in maintaining immune tolerance and preventing autoimmune diseases.

Applications of Recombinant Mouse VSIG2 Protein

Due to its unique structure and diverse range of activities, Recombinant Mouse VSIG2 Protein has a wide range of applications in scientific research. Some of the key applications include:

1. Studying immune responses

Recombinant Mouse VSIG2 Protein is commonly used in studies aimed at understanding the mechanisms of immune responses. Its ability to interact with immune cells and modulate their activity makes it a valuable tool in studying the complex processes involved in immune responses.

2. Vaccine development

The ability of Recombinant Mouse VSIG2 Protein to bind to antigens makes it a promising candidate for vaccine development. By incorporating this protein into vaccines, it may be possible to enhance the immune response and improve the efficacy of vaccines.

3. Autoimmune disease research

As Recombinant Mouse VSIG2 Protein has been shown to have immunosuppressive effects, it is also being studied as a potential treatment for autoimmune diseases. By inhibiting immune cell activity, this protein may help to prevent or treat conditions such as multiple sclerosis and rheumatoid arthritis.

4. Cancer immunotherapy

Recombinant Mouse VSIG2 Protein is also being investigated as a potential immunotherapy for cancer. Its ability to regulate immune responses and promote immune tolerance may be beneficial in treating certain types of cancer, such as melanoma and lung cancer.

5. Biomarker for disease diagnosis

Recent studies have shown that Recombinant Mouse VSIG2 Protein is highly expressed in certain types of cancer, making it a potential biomarker for disease diagnosis. By detecting the presence of this protein, it may be possible to diagnose cancer at an early stage and improve treatment outcomes.

Conclusion

Recombinant Mouse

Recombinant Mouse VSIG2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse VSIG2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products