Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Neisseria meningitidis neuA Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Neisseria meningitidis
Uniprot ID:
P0A0Z8
Molecular weight:
26.25 kDa

Original price was: $318.00.Current price is: $271.00.

50ug 15% OFF + 271 loyalty points
Met1–Ser228 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Neisseria meningitidis neuA Protein, C-His

Product name ARO-P16496-100
Uniprot ID P0A0Z8
Origin species Neisseria meningitidis
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.25 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms N-acylneuraminate cytidylyltransferase, 2.7.7.43, CMP-N-acetylneuraminic acid synthase, CMP-NeuNAc synthase, CMP-sialic acid synthase, neuA, siaB, synB
Reference ARO-P16496
Note For research use only.
Molecular Constructor
Met1–Ser228 His
Product name ARO-P16496-1MG
Uniprot ID P0A0Z8
Origin species Neisseria meningitidis
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.25 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms N-acylneuraminate cytidylyltransferase, 2.7.7.43, CMP-N-acetylneuraminic acid synthase, CMP-NeuNAc synthase, CMP-sialic acid synthase, neuA, siaB, synB
Reference ARO-P16496
Note For research use only.
Molecular Constructor
Met1–Ser228 His
Product name ARO-P16496-50
Uniprot ID P0A0Z8
Origin species Neisseria meningitidis
Expression system Prokaryotic expression
Raw Antigen Sequence MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHTINAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALETIGSNSGTVTLLQPTSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHPLKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPNGAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDIDTELDLQQAENILNHKES
Molecular weight 26.25 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser228
Aliases /Synonyms N-acylneuraminate cytidylyltransferase, 2.7.7.43, CMP-N-acetylneuraminic acid synthase, CMP-NeuNAc synthase, CMP-sialic acid synthase, neuA, siaB, synB
Reference ARO-P16496
Note For research use only.
Molecular Constructor
Met1–Ser228 His

There are no reviews yet.

Be the first to review “Recombinant Neisseria meningitidis neuA Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products