Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His & N-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Pseudomonas aeruginosa
Uniprot ID:
G3XD49
Molecular weight:
30.43 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Leu132–Ile294
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His & N-SUMO

Product name ARO-P12724-100
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 30.43 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706
Reference ARO-P12724
Note For research use only.
Molecular Constructor
Leu132–Ile294
Product name ARO-P12724-1MG
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 30.43 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706
Reference ARO-P12724
Note For research use only.
Molecular Constructor
Leu132–Ile294
Product name ARO-P12724-50
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 30.43 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706
Reference ARO-P12724
Note For research use only.
Molecular Constructor
Leu132–Ile294

Introduction

The Recombinant Pseudomonas aeruginosa PcrV protein is a key component of the type III secretion system (T3SS) in the Gram-negative bacterium Pseudomonas aeruginosa. This protein is a highly conserved antigen that plays a crucial role in the pathogenesis of P. aeruginosa infections. In this article, we will discuss the structure, activity, and potential applications of the Recombinant Pseudomonas aeruginosa PcrV protein.

Structure of Recombinant Pseudomonas aeruginosa PcrV Protein

The PcrV protein is a 30 kDa protein that is composed of 294 amino acids. It is a highly stable protein that forms a homodimer in solution. The crystal structure of the PcrV protein has been determined and it consists of two domains – an N-terminal α-helical domain and a C-terminal β-barrel domain. The α-helical domain is responsible for protein-protein interactions, while the β-barrel domain is involved in pore formation. The PcrV protein also contains a hydrophobic patch that is essential for its membrane localization and function.

Activity of Recombinant Pseudomonas aeruginosa PcrV Protein

The PcrV protein is a key component of the T3SS, which is a specialized secretion system used by P. aeruginosa to deliver effector proteins into host cells. The T3SS is essential for the virulence of P. aeruginosa and the PcrV protein is a major virulence factor. The PcrV protein is secreted by P. aeruginosa and forms a complex with other proteins, including PcrG and PopB/PopD, to form the translocon complex. This complex is responsible for the delivery of effector proteins into host cells.

The PcrV protein also has a pore-forming activity, which is essential for the secretion of effector proteins. It forms a pore in the host cell membrane, allowing the effector proteins to pass through and exert their effects. The PcrV protein has also been shown to have immunomodulatory effects, as it can inhibit the activation of host immune cells and promote bacterial survival.

Applications of Recombinant Pseudomonas aeruginosa PcrV Protein

The PcrV protein has been extensively studied for its potential as a vaccine candidate against P. aeruginosa infections. Recombinant PcrV protein has been shown to induce protective immune responses in animal models, making it a promising candidate for a P. aeruginosa vaccine. In fact, a recombinant PcrV-based vaccine has been developed and is currently in clinical trials for the prevention of P. aeruginosa infections in high-risk populations, such as cystic fibrosis patients.

In addition to its potential as a vaccine candidate, the PcrV protein has also been studied for its use in diagnostic tests for P. aeruginosa infections. Antibodies against PcrV have been shown to be highly specific for P. aeruginosa and can be used in diagnostic assays to detect the presence of the bacteria in clinical samples.

Furthermore, the PcrV protein has been investigated as a potential target for novel therapeutics against P. aeruginosa infections. Inhibitors of the PcrV protein have been developed that can block its pore-forming activity and inhibit the secretion of effector proteins, thus reducing the virulence of P. aeruginosa. These inhibitors have shown promising results in animal models and may lead to the development of new treatments for P. aeruginosa infections.

Conclusion

The Recombinant Pseudomonas aeruginosa PcrV protein is a key virulence factor and potential vaccine candidate for P. aeruginosa infections. Its structure and activity have been extensively studied, and it has shown promising results in various applications, including as

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His & N-SUMO

There are no reviews yet.

Be the first to review “Recombinant Pseudomonas aeruginosa PcrV Protein, N-His & N-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products