Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Uniprot ID:
G3XD49
Molecular weight:
20.20 kDa

Original price was: $438.00.Current price is: $392.00.

100ug 11% OFF + 392 loyalty points
Leu132–Ile294
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

Product name ARO-P10831-100
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706, Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Reference ARO-P10831
Note For research use only.
Molecular Constructor
Leu132–Ile294
Product name ARO-P10831-1MG
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706, Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Reference ARO-P10831
Note For research use only.
Molecular Constructor
Leu132–Ile294
Product name ARO-P10831-50
Uniprot ID G3XD49
Origin species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Expression system Prokaryotic expression
Raw Antigen Sequence LDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu132-Ile294
Aliases /Synonyms Type III secretion protein PcrV, pcrV, PA1706, Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Reference ARO-P10831
Note For research use only.
Molecular Constructor
Leu132–Ile294

Recombinant Pseudomonas aeruginosa PcrV Protein: Structure, Activity, and Applications

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where a specific gene is inserted into a host organism to produce a desired protein. One such protein is the Recombinant Pseudomonas aeruginosa PcrV Protein, which has gained significant attention in the field of immunology due to its potential as an antigen for vaccine development. In this article, we will discuss the structure, activity, and applications of this important protein.

Structure of Recombinant Pseudomonas aeruginosa PcrV Protein

Pseudomonas aeruginosa is a gram-negative bacterium that is known to cause severe infections in humans, especially in immunocompromised individuals. PcrV is a virulence factor of this bacterium, which is a key component of the type III secretion system (T3SS). The T3SS is a complex machinery that helps the bacterium to inject toxins into the host cells, enabling it to evade the host immune response. PcrV is a 294 amino acid protein that forms a trimeric structure, with each monomer consisting of three domains – the N-terminal domain, the central domain, and the C-terminal domain. The central domain is responsible for the trimerization of PcrV, while the N-terminal and C-terminal domains are involved in binding to the host cells.

Activity of Recombinant Pseudomonas aeruginosa PcrV Protein

The main function of PcrV is to facilitate the delivery of toxins into the host cells. It does so by binding to the host cell surface and forming a pore, which allows the passage of the toxins. This activity of PcrV is crucial for the virulence of Pseudomonas aeruginosa. However, in recent years, researchers have discovered that PcrV can also elicit an immune response in the host, making it a potential antigen for vaccine development. Studies have shown that PcrV can induce the production of antibodies and T cells, which can recognize and neutralize the toxin-delivery function of PcrV, thereby protecting the host from Pseudomonas aeruginosa infection.

Applications of Recombinant Pseudomonas aeruginosa PcrV Protein

The potential of PcrV as an antigen has led to its use in various vaccine development studies. Recombinant PcrV protein has been successfully produced in different expression systems, including Escherichia coli and Pichia pastoris. These recombinant proteins have been used to immunize animal models, and the results have shown promising protection against Pseudomonas aeruginosa infection. Furthermore, PcrV has also been used as a target for monoclonal antibody development, which has shown to be effective in neutralizing the virulence of Pseudomonas aeruginosa.

In addition to its use in vaccine development, PcrV has also been studied for its potential as a diagnostic tool. As PcrV is a major virulence factor of Pseudomonas aeruginosa, the detection of PcrV-specific antibodies in patient sera can indicate an ongoing infection. This can aid in the early diagnosis and treatment of Pseudomonas aeruginosa infections.

Conclusion

In conclusion, Recombinant Pseudomonas aeruginosa PcrV Protein is an important antigen that has both virulence and immunogenic properties. Its trimeric structure and activity as a toxin-delivery protein make it a potential target for vaccine development against Pseudomonas aeruginosa infections. Furthermore, its use as a diagnostic tool can aid in the early detection and treatment of these infections. Further research and development in this field can lead to the production of an effective PcrV-based

SDS-PAGE for Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

SDS-PAGE for Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Pseudomonas aeruginosa PcrV Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Pseudomonas aeruginosa PcrV Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products