Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant SARS-CoV-2 S Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Uniprot ID:
P0DTC2
Molecular weight:
19.21 kDa

$387.00

100ug + 387 loyalty points
His Asn679–Phe833
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant SARS-CoV-2 S Protein, N-His

Recombinant SARS-CoV-2 S Protein, N-His

Product name Recombinant SARS-CoV-2 S Protein, N-His
Uniprot ID P0DTC2
Origin species Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence NSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGF
Molecular weight 19.21 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn679-Phe833
Aliases /Synonyms Spike glycoprotein, S glycoprotein, E2, Peplomer protein, Spike protein S1, Spike protein S2, Spike protein S2', S
Reference PX-COV-P011
Note For research use only.
Molecular Constructor
His Asn679–Phe833

There are no reviews yet.

Be the first to review “Recombinant SARS-CoV-2 S Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products