Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Staphylococcus aureus entC2/SEC2 Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus aureus
Uniprot ID:
P34071
Molecular weight:
31.09 kDa

Original price was: $309.00.Current price is: $271.00.

50ug 12% OFF + 271 loyalty points
Glu28–Gly266 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Staphylococcus aureus entC2/SEC2 Protein, C-His

Product name ARO-P16722-100
Uniprot ID P34071
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Molecular weight 31.09 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu28-Gly266
Aliases /Synonyms Enterotoxin type C-2, SEC2, entC2
Reference ARO-P16722
Note For research use only.
Molecular Constructor
Glu28–Gly266 His
Product name ARO-P16722-1MG
Uniprot ID P34071
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Molecular weight 31.09 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu28-Gly266
Aliases /Synonyms Enterotoxin type C-2, SEC2, entC2
Reference ARO-P16722
Note For research use only.
Molecular Constructor
Glu28–Gly266 His
Product name ARO-P16722-50
Uniprot ID P34071
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Molecular weight 31.09 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu28-Gly266
Aliases /Synonyms Enterotoxin type C-2, SEC2, entC2
Reference ARO-P16722
Note For research use only.
Molecular Constructor
Glu28–Gly266 His

SDS-PAGE for Recombinant Staphylococcus aureus entC2/SEC2 Protein, C-His

SDS-PAGE for Recombinant Staphylococcus aureus entC2/SEC2 Protein, C-His

Recombinant Staphylococcus aureus entC2/SEC2 Protein, C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Staphylococcus aureus entC2/SEC2 Protein, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products