Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Treponema pallidum/TP TPP17/17 kDa lipoprotein Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Treponema pallidum (strain Nichols)
Uniprot ID:
P29722
Molecular weight:
40.74 kDa

Original price was: $458.00.Current price is: $392.00.

100ug 14% OFF + 392 loyalty points
Cys22–Lys156
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Treponema pallidum/TP TPP17/17 kDa lipoprotein Protein, N-GST

Recombinant Treponema pallidum/TP TPP17/17 kDa lipoprotein Protein, N-GST

Product name ARO-P12737-100
Uniprot ID P29722
Origin species Treponema pallidum (strain Nichols)
Expression system Prokaryotic expression
Raw Antigen Sequence CVSCTTVCPHAGKAKAEKVECALKGGIFRGTLPAADCPGIDTTVTFNADGTAQKVELALEKKSAPSPLTYRGTWMVREDGIVELSLVSSEQSKAPHEKELYELIDSNSVRYMGAPGAGKPSKEMAPFYVLKKTKK
Molecular weight 40.74 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys22-Lys156
Aliases /Synonyms 17 kDa lipoprotein, tpp17, TP_0435, Treponema Pallidum (TP,Syphilis)
Reference ARO-P12737
Note For research use only.
Molecular Constructor
Cys22–Lys156
Product name ARO-P12737-1MG
Uniprot ID P29722
Origin species Treponema pallidum (strain Nichols)
Expression system Prokaryotic expression
Raw Antigen Sequence CVSCTTVCPHAGKAKAEKVECALKGGIFRGTLPAADCPGIDTTVTFNADGTAQKVELALEKKSAPSPLTYRGTWMVREDGIVELSLVSSEQSKAPHEKELYELIDSNSVRYMGAPGAGKPSKEMAPFYVLKKTKK
Molecular weight 40.74 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys22-Lys156
Aliases /Synonyms 17 kDa lipoprotein, tpp17, TP_0435, Treponema Pallidum (TP,Syphilis)
Reference ARO-P12737
Note For research use only.
Molecular Constructor
Cys22–Lys156
Product name ARO-P12737-50
Uniprot ID P29722
Origin species Treponema pallidum (strain Nichols)
Expression system Prokaryotic expression
Raw Antigen Sequence CVSCTTVCPHAGKAKAEKVECALKGGIFRGTLPAADCPGIDTTVTFNADGTAQKVELALEKKSAPSPLTYRGTWMVREDGIVELSLVSSEQSKAPHEKELYELIDSNSVRYMGAPGAGKPSKEMAPFYVLKKTKK
Molecular weight 40.74 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys22-Lys156
Aliases /Synonyms 17 kDa lipoprotein, tpp17, TP_0435, Treponema Pallidum (TP,Syphilis)
Reference ARO-P12737
Note For research use only.
Molecular Constructor
Cys22–Lys156

Recombinant Treponema pallidum/TP TPP17/17 kDa lipoprotein Protein, N-GST

There are no reviews yet.

Be the first to review “Recombinant Treponema pallidum/TP TPP17/17 kDa lipoprotein Protein, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products