Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Staphylococcus GlmCat Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus
Molecular weight:
38.20 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Staphylococcus GlmCat Recombinant Protein

Product name Staphylococcus GlmCat Recombinant Protein
Origin species Staphylococcus
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLVNAKDLTAPTAVKPTTSAAKDYNYTYVIKNGNGYYYVTPNSDTAKYSLKAFNEQPFAVVKEQVINGQTWYYGKLSNGKLAWIKSTDLAKELIKYNQTGMTLNQVAQIQAGLQYKPQVQRVPGKWTGANFNDVKHAMDTKRLAQDPALKYQFLRLDQPQNISIDKINQFLKGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGADVVNNKVVTNSNTKYHNVFGIAAYDNDPL
Molecular weight 38.20 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession KEK36855.1
Spec:Entrez GeneID 5330556
Spec:SwissProtID A6QFR2
NCBI Reference KEK36855.1
Aliases /Synonyms GlmCat, Bifunctional autolysin
Reference PX-P2072
Note For research use only
Molecular Constructor
Partial Yes
Product name Staphylococcus GlmCat Recombinant Protein
Origin species Staphylococcus
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLVNAKDLTAPTAVKPTTSAAKDYNYTYVIKNGNGYYYVTPNSDTAKYSLKAFNEQPFAVVKEQVINGQTWYYGKLSNGKLAWIKSTDLAKELIKYNQTGMTLNQVAQIQAGLQYKPQVQRVPGKWTGANFNDVKHAMDTKRLAQDPALKYQFLRLDQPQNISIDKINQFLKGKGVLENQGAAFNKAAQMYGINEVYLISHALLETGNGTSQLAKGADVVNNKVVTNSNTKYHNVFGIAAYDNDPL
Molecular weight 38.20 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession KEK36855.1
Spec:Entrez GeneID 5330556
Spec:SwissProtID A6QFR2
NCBI Reference KEK36855.1
Aliases /Synonyms GlmCat, Bifunctional autolysin
Reference PX-P2072
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Staphylococcus GlmCat Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products