Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Streptococcus 6His-Protein G

Host species:
Escherichia coli (E.coli)
Origin species:
Streptococcus
Molecular weight:
20.96 KDa

$675.00

10mg + 675 loyalty points
Partial Yes
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Streptococcus 6His-Protein G

Product name Streptococcus 6His-Protein G
Origin species Streptococcus
Expression system Procaryotic expression
Raw Antigen Sequence MGKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEHHHHHH
Molecular weight 20.96 KDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:SwissProtID P19909
NCBI Reference CAA37410.1
Aliases /Synonyms 6His-Protein G
Reference PX-P2102
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Streptococcus 6His-Protein G”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products