Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

SuHV-1 gL/Envelope glycoprotein L, C-Strep

Host species:
Mammalian cells
Origin species:
Suid herpesvirus 1 (SuHV-1) (Pseudorabies virus)
Uniprot ID:
P52512

Original price was: $318.00.Current price is: $271.00.

50ug 15% OFF + 271 loyalty points
Val17–Glu156 Strep
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

SuHV-1 gL/Envelope glycoprotein L, C-Strep

Product name ARO-P18506-100
Uniprot ID P52512
Origin species Suid herpesvirus 1 (SuHV-1) (Pseudorabies virus)
Expression system Eukaryotic expression
Raw Antigen Sequence VPGTGVAGNPHGLDAIFEPPVTPAPPTRAPRREELEWDDEDHPLLGLEPPVGSRCHPYIAYSLPPDMTAVTSVVVKPYCSPPEVILWASGTAYLVNPFVAIQALAIGEPLNEAALKELGEVAVHKDSLPPLRYNGGPPAE
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val17-Glu156
Aliases /Synonyms Envelope glycoprotein L, gL, gL, UL1
Reference ARO-P18506
Note For research use only.
Molecular Constructor
Val17–Glu156 Strep
Product name ARO-P18506-1MG
Uniprot ID P52512
Origin species Suid herpesvirus 1 (SuHV-1) (Pseudorabies virus)
Expression system Eukaryotic expression
Raw Antigen Sequence VPGTGVAGNPHGLDAIFEPPVTPAPPTRAPRREELEWDDEDHPLLGLEPPVGSRCHPYIAYSLPPDMTAVTSVVVKPYCSPPEVILWASGTAYLVNPFVAIQALAIGEPLNEAALKELGEVAVHKDSLPPLRYNGGPPAE
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val17-Glu156
Aliases /Synonyms Envelope glycoprotein L, gL, gL, UL1
Reference ARO-P18506
Note For research use only.
Molecular Constructor
Val17–Glu156 Strep
Product name ARO-P18506-50
Uniprot ID P52512
Origin species Suid herpesvirus 1 (SuHV-1) (Pseudorabies virus)
Expression system Eukaryotic expression
Raw Antigen Sequence VPGTGVAGNPHGLDAIFEPPVTPAPPTRAPRREELEWDDEDHPLLGLEPPVGSRCHPYIAYSLPPDMTAVTSVVVKPYCSPPEVILWASGTAYLVNPFVAIQALAIGEPLNEAALKELGEVAVHKDSLPPLRYNGGPPAE
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val17-Glu156
Aliases /Synonyms Envelope glycoprotein L, gL, gL, UL1
Reference ARO-P18506
Note For research use only.
Molecular Constructor
Val17–Glu156 Strep

There are no reviews yet.

Be the first to review “SuHV-1 gL/Envelope glycoprotein L, C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products