Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Toxoplasma gondii
Uniprot ID:
Q25C72
Molecular weight:
17,41 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein

Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein

Product name Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein
Uniprot ID Q25C72
Uniprot link http://www.uniprot.org/uniprot/Q25C72
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTAVAADSGGVRQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQ GDSLAEDDTTSDAAEGDVDPFPALANEGKSEARGPSLEERIEEQGTRRRYSSVEEPQAKVPSKRTQKRHRKLAAALEHHH HHH
Molecular weight 17,41 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM if native conditions. PBS, imidazole 400mM, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_002371939
Spec:Entrez GeneID 7895853
Spec:SwissProtID S8EZ84
NCBI Reference XP_002371939
Aliases /Synonyms GRA6Nt(41-152)(76K), granule antigen protein GRA6
Reference PX-P1101
Note For research use only
Molecular Constructor
Partial Yes
Product name Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein
Uniprot ID Q25C72
Uniprot link http://www.uniprot.org/uniprot/Q25C72
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTAVAADSGGVRQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQ GDSLAEDDTTSDAAEGDVDPFPALANEGKSEARGPSLEERIEEQGTRRRYSSVEEPQAKVPSKRTQKRHRKLAAALEHHH HHH
Molecular weight 17,41 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM if native conditions. PBS, imidazole 400mM, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_002371939
Spec:Entrez GeneID 7895853
Spec:SwissProtID S8EZ84
NCBI Reference XP_002371939
Aliases /Synonyms GRA6Nt(41-152)(76K), granule antigen protein GRA6
Reference PX-P1101
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products