Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Toxoplasma gondii GRA6Nt(41-152)(RH) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Toxoplasma gondii
Uniprot ID:
Q27003
Molecular weight:
17,46 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Toxoplasma gondii GRA6Nt(41-152)(RH) Recombinant Protein

Product name Toxoplasma gondii GRA6Nt(41-152)(RH) Recombinant Protein
Uniprot ID Q27003
Uniprot link http://www.uniprot.org/uniprot/Q27003
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Raw Antigen Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTRVAADSGGVKQTPSETGSSGGQQEAAGTTEDYVNSSAMGGGQ GDSLAEDDTTSDAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKRHRKLAAALEHHH HHH
Molecular weight 17,46 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM in native conditions. NaH2PO4 100mM, TrisBase 10mM, Urea 8M, imidazole 400mM in denaturig conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAC37235.1
Spec:SwissProtID Q27003
NCBI Reference AAC37235.1
Aliases /Synonyms GRA6Nt(41-152)(RH), dense granule antigen
Reference PX-P1102
Note For research use only
Molecular Constructor
Partial Yes
Product name Toxoplasma gondii GRA6Nt(41-152)(RH) Recombinant Protein
Uniprot ID Q27003
Uniprot link http://www.uniprot.org/uniprot/Q27003
Origin species Toxoplasma gondii
Expression system Prokaryotic expression
Raw Antigen Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTRVAADSGGVKQTPSETGSSGGQQEAAGTTEDYVNSSAMGGGQ GDSLAEDDTTSDAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKRHRKLAAALEHHH HHH
Molecular weight 17,46 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM in native conditions. NaH2PO4 100mM, TrisBase 10mM, Urea 8M, imidazole 400mM in denaturig conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAC37235.1
Spec:SwissProtID Q27003
NCBI Reference AAC37235.1
Aliases /Synonyms GRA6Nt(41-152)(RH), dense granule antigen
Reference PX-P1102
Note For research use only
Molecular Constructor
Partial Yes

Toxoplasma gondii GRA6Nt(41-152)(RH) Recombinant Protein

There are no reviews yet.

Be the first to review “Toxoplasma gondii GRA6Nt(41-152)(RH) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products