Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Trichinella spiralis GST24 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Trichinella spiralis
Uniprot ID:
Q0H8U8
Molecular weight:
25,32 kDa

$667.00

100ug + 667 loyalty points
Full-length Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Trichinella spiralis GST24 Recombinant Protein

Trichinella spiralis GST24 Recombinant Protein

Product name Trichinella spiralis GST24 Recombinant Protein
Uniprot ID Q0H8U8
Uniprot link http://www.uniprot.org/uniprot/Q0H8U8
Origin species Trichinella spiralis
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMPLYKLVYFPIRGLAEPIRLLLHDQRVEFLDNRIQQKDWPEIKSQMLFGQVPCLYEDDQPIVQSGAIMR HLGRRFGLYGNAEEMTYVDQIYEGVVDLRLKYARLIYSDSFHESKGKFINEVLPDELAKFEKILTGKKYILDDEITFADY ALAELLDVLLILSSSCLENFTALTIYHSRFMNRPNLKRYLSSDIRKNAKINGNENK
Molecular weight 25,32 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ABA42914.1
Spec:SwissProtID Q0H8U8
NCBI Reference ABA42914.1
Aliases /Synonyms GST24, glutathione-S-transferase
Reference PX-P1104
Note For research use only
Molecular Constructor
Full-length Yes
Product name Trichinella spiralis GST24 Recombinant Protein
Uniprot ID Q0H8U8
Uniprot link http://www.uniprot.org/uniprot/Q0H8U8
Origin species Trichinella spiralis
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMPLYKLVYFPIRGLAEPIRLLLHDQRVEFLDNRIQQKDWPEIKSQMLFGQVPCLYEDDQPIVQSGAIMR HLGRRFGLYGNAEEMTYVDQIYEGVVDLRLKYARLIYSDSFHESKGKFINEVLPDELAKFEKILTGKKYILDDEITFADY ALAELLDVLLILSSSCLENFTALTIYHSRFMNRPNLKRYLSSDIRKNAKINGNENK
Molecular weight 25,32 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ABA42914.1
Spec:SwissProtID Q0H8U8
NCBI Reference ABA42914.1
Aliases /Synonyms GST24, glutathione-S-transferase
Reference PX-P1104
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Trichinella spiralis GST24 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products