Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Trichinella spiralis NBL2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Trichinella spiralis
Uniprot ID:
B0F9T2
Molecular weight:
45,20 kDa

$667.00

100ug + 667 loyalty points
Partial Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Trichinella spiralis NBL2 Recombinant Protein

Trichinella spiralis NBL2 Recombinant Protein

Product name Trichinella spiralis NBL2 Recombinant Protein
Uniprot ID B0F9T2
Uniprot link http://www.uniprot.org/uniprot/B0F9T2
Origin species Trichinella spiralis
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLQILGETTHYGRNDPVMLRNAHEALFSSDLKQESGVFHKLLELEESSTMGILTTMKVVMQDTDCPVSFAL LSYYDVLVNCQGEGRRKHCTMEYTHRNPSKATVSKCFEEVEEPLIIPQRVKMIGGRAVYIDSNADVEEQMQMLGETTHYG RNDPVMLPKAREALFSSDSKEQSGVLHKLVELEESSTMGILTTMKVVIQDTECRVSSAYSSYYDVLHYCHGKGPRKHCTL EYRHRTPSTATVSECFEEVEEPLIVPQRVQRVNGRTIYLDSSDDVEEQVVSQRSQMLGGTTKYTDSNVHIKEEVKQAIFE SDKKKSSGTYLLLDKIVEGFNMGISSRFQVLVKETECGIKEKAFNSYEDVYKNCSGSGDSKVCSVEYKYFDPTKSTVEC
Molecular weight 45,20 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer NaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ABY60755.1
Spec:SwissProtID B0F9T2
NCBI Reference ABY60755.1
Aliases /Synonyms NBL2∆Nter, hypothetical protein
Reference PX-P1129
Note For research use only
Molecular Constructor
Partial Yes
Product name Trichinella spiralis NBL2 Recombinant Protein
Uniprot ID B0F9T2
Uniprot link http://www.uniprot.org/uniprot/B0F9T2
Origin species Trichinella spiralis
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLQILGETTHYGRNDPVMLRNAHEALFSSDLKQESGVFHKLLELEESSTMGILTTMKVVMQDTDCPVSFAL LSYYDVLVNCQGEGRRKHCTMEYTHRNPSKATVSKCFEEVEEPLIIPQRVKMIGGRAVYIDSNADVEEQMQMLGETTHYG RNDPVMLPKAREALFSSDSKEQSGVLHKLVELEESSTMGILTTMKVVIQDTECRVSSAYSSYYDVLHYCHGKGPRKHCTL EYRHRTPSTATVSECFEEVEEPLIVPQRVQRVNGRTIYLDSSDDVEEQVVSQRSQMLGGTTKYTDSNVHIKEEVKQAIFE SDKKKSSGTYLLLDKIVEGFNMGISSRFQVLVKETECGIKEKAFNSYEDVYKNCSGSGDSKVCSVEYKYFDPTKSTVEC
Molecular weight 45,20 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer NaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ABY60755.1
Spec:SwissProtID B0F9T2
NCBI Reference ABY60755.1
Aliases /Synonyms NBL2∆Nter, hypothetical protein
Reference PX-P1129
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Trichinella spiralis NBL2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products