Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Trypanosoma PLB Recombinant Protein C-Ter His tag

Host species:
Escherichia coli (E.coli)
Origin species:
Trypanosoma
Uniprot ID:
F9WF01
Molecular weight:
33,48 kDa

$392.00

+ 392 loyalty points
Full-length Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Trypanosoma PLB Recombinant Protein C-Ter His tag

Product name Trypanosoma PLB Recombinant Protein C-Ter His tag
Uniprot ID F9WF01
Uniprot link http://www.uniprot.org/uniprot/F9WF01
Origin species Trypanosoma
Expression system Prokaryotic expression
Sequence MKLMLKNMTRDTFWVVEQLPGKAAPLGITAKDMTSVLNTSGYWASYNRPYFPNVYNLSGIHDMWKKYGDFYSYKNYSRAR IFARDEGKVEDLASMKRLMRYNNYTKDPFSLIPNCSRTNSSFDDEETAPSVCKPPYSAMLSIAARGDLNPTGNDTFYGPL YRSVGHVDSAATDAKIATWSGMMKGNGTYTAHVICGPTTDGLPPFSWKNDIFDPMPPTFGLPKVYNFSFVVMTTVLPSPS KGSLWSRTGIIAIVAALVVGTIAVVLMRPRKDSEEDDALPEETEGLVDPIERSHNHRHKH
Molecular weight 33,48 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession CCD15867.1
Spec:SwissProtID F9WF01
NCBI Reference CCD15867.1
Aliases /Synonyms PLB, unnamed protein product
Reference PX-P1142
Note For research use only
Molecular Constructor
Full-length Yes
Product name Trypanosoma PLB Recombinant Protein C-Ter His tag
Uniprot ID F9WF01
Uniprot link http://www.uniprot.org/uniprot/F9WF01
Origin species Trypanosoma
Expression system Prokaryotic expression
Sequence MKLMLKNMTRDTFWVVEQLPGKAAPLGITAKDMTSVLNTSGYWASYNRPYFPNVYNLSGIHDMWKKYGDFYSYKNYSRAR IFARDEGKVEDLASMKRLMRYNNYTKDPFSLIPNCSRTNSSFDDEETAPSVCKPPYSAMLSIAARGDLNPTGNDTFYGPL YRSVGHVDSAATDAKIATWSGMMKGNGTYTAHVICGPTTDGLPPFSWKNDIFDPMPPTFGLPKVYNFSFVVMTTVLPSPS KGSLWSRTGIIAIVAALVVGTIAVVLMRPRKDSEEDDALPEETEGLVDPIERSHNHRHKH
Molecular weight 33.48 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession CCD15867.1
Spec:SwissProtID F9WF01
NCBI Reference CCD15867.1
Aliases /Synonyms PLB, unnamed protein product
Reference PX-P1142
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Trypanosoma PLB Recombinant Protein C-Ter His tag”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products