Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Up-regulated in infective sporozoites(PBANKA_0501200)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A509AFU9
Molecular weight:
18.09kDa

$250.00

50ug + 250 loyalty points
Glu79–Ile220
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Up-regulated in infective sporozoites(PBANKA_0501200)

Product name Up-regulated in infective sporozoites(PBANKA_0501200)
Uniprot ID A0A509AFU9
Uniprot link http://www.uniprot.org/uniprot/A0A509AFU9
Expression system Prokaryotic expression
Raw Antigen Sequence EVREKFRIGKRIKEFDDVNTPQDISLINPVENPYPENSPENSPENSPEKYIEESHKHYTKRFLEQYTEPKPSDHTYSYSPTEEAYNTHYMASDTHEDYGKLFTDEHKDEINDNIVYHDELSDLVGEGNNVYNMENKSFGPYI
Molecular weight 18.09kDa
Purity estimated 80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu79-Ile220
Reference PX-P4537
Note For research use only
Molecular Constructor
Glu79–Ile220
Product name Up-regulated in infective sporozoites(PBANKA_0501200)
Uniprot ID A0A509AFU9
Uniprot link http://www.uniprot.org/uniprot/A0A509AFU9
Expression system Prokaryotic expression
Raw Antigen Sequence EVREKFRIGKRIKEFDDVNTPQDISLINPVENPYPENSPENSPENSPEKYIEESHKHYTKRFLEQYTEPKPSDHTYSYSPTEEAYNTHYMASDTHEDYGKLFTDEHKDEINDNIVYHDELSDLVGEGNNVYNMENKSFGPYI
Molecular weight 18.09kDa
Purity estimated 80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu79-Ile220
Reference PX-P4537
Note For research use only
Molecular Constructor
Glu79–Ile220

Up-regulated in infective sporozoites(PBANKA_0501200)

There are no reviews yet.

Be the first to review “Up-regulated in infective sporozoites(PBANKA_0501200)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products