Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vaccinia virus/VACV L1R Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Vaccinia virus (VACV)
Uniprot ID:
P20540

Original price was: $318.00.Current price is: $271.00.

50ug 15% OFF + 271 loyalty points
Gly2–Gly183 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vaccinia virus/VACV L1R Recombinant Protein, C-His

Product name ARO-P17993-100
Uniprot ID P20540
Origin species Vaccinia virus (VACV)
Expression system Eukaryotic expression
Raw Antigen Sequence GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Gly183
Aliases /Synonyms Protein L1, L1R, EFC-associated protein OPG095, Virion membrane protein M25, OPG099
Reference ARO-P17993
Note For research use only.
Molecular Constructor
Gly2–Gly183 His
Product name ARO-P17993-1MG
Uniprot ID P20540
Origin species Vaccinia virus (VACV)
Expression system Eukaryotic expression
Raw Antigen Sequence GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Gly183
Aliases /Synonyms Protein L1, L1R, EFC-associated protein OPG095, Virion membrane protein M25, OPG099
Reference ARO-P17993
Note For research use only.
Molecular Constructor
Gly2–Gly183 His
Product name ARO-P17993-50
Uniprot ID P20540
Origin species Vaccinia virus (VACV)
Expression system Eukaryotic expression
Raw Antigen Sequence GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Gly183
Aliases /Synonyms Protein L1, L1R, EFC-associated protein OPG095, Virion membrane protein M25, OPG099
Reference ARO-P17993
Note For research use only.
Molecular Constructor
Gly2–Gly183 His

There are no reviews yet.

Be the first to review “Vaccinia virus/VACV L1R Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products