Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Volume-regulated anion channel subunit LRRC8D (Lrrc8d)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q5U308
Molecular weight:
14.1kDa

$250.00

50ug + 250 loyalty points
Pro501–Leu613 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Volume-regulated anion channel subunit LRRC8D (Lrrc8d)

Volume-regulated anion channel subunit LRRC8D (Lrrc8d)

Product name Volume-regulated anion channel subunit LRRC8D (Lrrc8d)
Uniprot ID Q5U308
Uniprot link https://www.uniprot.org/uniprot/Q5U308
Expression system Prokaryotic expression
Sequence MGPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHLGSHHHHHH
Molecular weight 14.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro501-Leu613
Protein Accession Q5U308
Spec:Entrez GeneID 305131
Spec:SwissProtID Q5U308
NCBI Reference Q5U308
Aliases /Synonyms Leucine-rich repeat-containing protein 5,Leucine-rich repeat-containing protein 8D,Lrrc5
Reference PX-P4696
Note For research use only
Molecular Constructor
Pro501–Leu613 His
Product name Volume-regulated anion channel subunit LRRC8D (Lrrc8d)
Uniprot ID Q5U308
Uniprot link https://www.uniprot.org/uniprot/Q5U308
Expression system Prokaryotic expression
Sequence MGPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHLGSHHHHHH
Molecular weight 14.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >75% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro501-Leu613
Protein Accession Q5U308
Spec:Entrez GeneID 305131
Spec:SwissProtID Q5U308
NCBI Reference Q5U308
Aliases /Synonyms Leucine-rich repeat-containing protein 5,Leucine-rich repeat-containing protein 8D,Lrrc5
Reference PX-P4696
Note For research use only
Molecular Constructor
Pro501–Leu613 His

There are no reviews yet.

Be the first to review “Volume-regulated anion channel subunit LRRC8D (Lrrc8d)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products