Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

VSVG Protein- Vesicular stomatitis virus VSVG IND1 Recombinant Protein

Origin species:
Vesicular stomatitis virus
Uniprot ID:
B5AGV3
Molecular weight:
58.44 kDa

$250.00

50ug + 250 loyalty points
His Met1–Ser467
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Vesicular stomatitis virus VSVG IND1 Recombinant Protein

VSVG Protein- Vesicular stomatitis virus VSVG IND1 Recombinant Protein

Product name VSVG Protein- Vesicular stomatitis virus VSVG IND1 Recombinant Protein
Uniprot ID B5AGV3
Uniprot link http://www.uniprot.org/uniprot/B5AGV3
Origin species Vesicular stomatitis virus
Expression system Eukaryotic expression
Raw Antigen Sequence MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLVGTALQVKMPKSHKAIQADGWMCHASKW VTTCDFRWYGPKYITHSIRSFTPSVEQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAAIVQVTPHHVLVDEYTGEWV DSQFINGKCSNDICPTVHNSTTWHSDYKVKGLCDSNLISMDITFFSEDGELSSLGKKGTGFRSNYFAYETGDKACKMQYC KHWGVRLPSGVWFEMADKDLFAAARFPECPEGSSISAPSQTSVDVSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSY LAPKNPGTGPVFTIINGTLKYFETRYIRVDIAAPILSRMVGMISGTTTERVLWDDWAPYEDVEIGPNGVLRTSSGYKFPL YMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDGETLFFGDTGLSKNPIEFVEGWFSSWKSSIASFFFTIGLIIGLFL VLRVGIYLCIKLKHTKKRQIYTDIEMNRLGKGGHNHRHKH
Molecular weight 58.44 kDa
Protein delivered with Tag? N-Terminal His Tag
Purity estimated 90%
Buffer Tris-HC 50mMl, NaCl 150mM, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Insect
Fragment Type Full-length
Spec:SwissProtID B5AGV3
Aliases /Synonyms VSVG IND1, G protein ou Glycoprotein
Reference PX-P2100
Note For research use only
Molecular Constructor
His Met1–Ser467
Product name VSVG Protein- Vesicular stomatitis virus VSVG IND1 Recombinant Protein
Uniprot ID B5AGV3
Uniprot link http://www.uniprot.org/uniprot/B5AGV3
Origin species Vesicular stomatitis virus
Expression system Eukaryotic expression
Raw Antigen Sequence MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLVGTALQVKMPKSHKAIQADGWMCHASKW VTTCDFRWYGPKYITHSIRSFTPSVEQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAAIVQVTPHHVLVDEYTGEWV DSQFINGKCSNDICPTVHNSTTWHSDYKVKGLCDSNLISMDITFFSEDGELSSLGKKGTGFRSNYFAYETGDKACKMQYC KHWGVRLPSGVWFEMADKDLFAAARFPECPEGSSISAPSQTSVDVSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSY LAPKNPGTGPVFTIINGTLKYFETRYIRVDIAAPILSRMVGMISGTTTERVLWDDWAPYEDVEIGPNGVLRTSSGYKFPL YMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDGETLFFGDTGLSKNPIEFVEGWFSSWKSSIASFFFTIGLIIGLFL VLRVGIYLCIKLKHTKKRQIYTDIEMNRLGKGGHNHRHKH
Molecular weight 58.44 kDa
Protein delivered with Tag? N-Terminal His Tag
Purity estimated 90%
Buffer Tris-HC 50mMl, NaCl 150mM, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Insect
Fragment Type Full-length
Spec:SwissProtID B5AGV3
Aliases /Synonyms VSVG IND1, G protein ou Glycoprotein
Reference PX-P2100
Note For research use only
Molecular Constructor
His Met1–Ser467

General information on VSVG IND1

VSVG IND1 is a subtype of Vesicular stomatitis virus (VSV) family of glycoproteins. The latter mediate both cell attachment and membrane fusion. Unlike many other low-pH-induced viral fusion proteins, VSV glycoproteins deliver reversible fusogenic conformational transitions. VSV-G has a three-stage fusion kinetics:
• G-protein conformational change which is reversible and pH-dependent.
• Reversible trimerization and clustering of the G-protein fusion loops.
• Folding back of a cluster of extended trimers into their post-fusion conformations.
VSV NJ glycoprotein contains 517 amino acids and is glycosylated at position 178 and 335. Unlike VSV Indiana (VSIV), another major serotype of VSV, VSV NJ is not acylated. The two serotypes also differentiate in terms of antigenic structure. VSV NJ has a faster glycoprotein folding intracellularly and with less dependence on glycosylation.

SDS-PAGE for Vesicular stomatitis virus VSVG IND1 Recombinant Protein

SDS-PAGE for Vesicular stomatitis virus VSVG IND1 Recombinant Protein

Vesicular stomatitis virus VSVG IND1 Recombinant Protein on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “VSVG Protein- Vesicular stomatitis virus VSVG IND1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products