Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Xenopus rtTA Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Xenopus
Molecular weight:
30,56 kDa

$250.00

+ 250 loyalty points
Full-length
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Xenopus rtTA Recombinant Protein

Xenopus rtTA Recombinant Protein

Product name Xenopus rtTA Recombinant Protein
Origin species Xenopus
Expression system Prokaryotic expression
Sequence MGHHHHHHHHHHSSGHIDDDDKHNMSRLDKSKVINGALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALP IEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTRPTEKQYETLENQLAFLCQQGFSLENALYALSA VGHFTLGCVLEEQEHQVAKEERETPTTDSMPPLLRQAIELFDRQGAEPAFLFGLELIICGLEKQLKCESGGPADALDDFD LDMLPADALDDFDLDMLPADALDDFDLDMLPG
Molecular weight 30,56 kDa
Purity estimated 90%
Buffer PBS, imidazole 400mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ABC65842.1
NCBI Reference ABC65842.1
Aliases /Synonyms rtTA, rtTA-M2.alt [Expression vector peTetOn(PacI)], doxycycline-activated transcriptional activator
Reference PX-P1148
Note For research use only
Molecular Constructor
Full-length
Product name Xenopus rtTA Recombinant Protein
Origin species Xenopus
Expression system Prokaryotic expression
Sequence MGHHHHHHHHHHSSGHIDDDDKHNMSRLDKSKVINGALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALP IEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTRPTEKQYETLENQLAFLCQQGFSLENALYALSA VGHFTLGCVLEEQEHQVAKEERETPTTDSMPPLLRQAIELFDRQGAEPAFLFGLELIICGLEKQLKCESGGPADALDDFD LDMLPADALDDFDLDMLPADALDDFDLDMLPG
Molecular weight 30,56 kDa
Purity estimated 90%
Buffer PBS, imidazole 400mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession ABC65842.1
NCBI Reference ABC65842.1
Aliases /Synonyms rtTA, rtTA-M2.alt [Expression vector peTetOn(PacI)], doxycycline-activated transcriptional activator
Reference PX-P1148
Note For research use only
Molecular Constructor
Full-length

General information on Xenopus rtTA Recombinant Protein

Fusion protein of reverse tetracycline repressor protein and immediate early protein 1 activation domain. Used in Tetracycline repressor-regulated gene repression experiments.

  • Bäckman CM, Zhang Y, Hoffer BJ, Tomac AC. Tetracycline-inducible expression systems for the generation of transgenic animals: a comparison of various inducible systems carried in a single vector. J Neurosci Methods. 2004 Oct 30;139(2):257-62. PubMed PMID: 15488239, https://doi.org/10.1016/j.jneumeth.2004.05.012

There are no reviews yet.

Be the first to review “Xenopus rtTA Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products