Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zebrafish slc2a10 Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Zebrafish
Uniprot ID:
F1R0H0

Original price was: $320.00.Current price is: $271.00.

50ug 15% OFF + 271 loyalty points
GST Arg323–Lys376 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Zebrafish slc2a10 Recombinant Protein, N-GST & C-His

Product name ARO-P17893-100
Uniprot ID F1R0H0
Origin species Zebrafish
Expression system Prokaryotic expression
Raw Antigen Sequence RQSVIDTTKRCTSVGPHSNLTLSAEHDEGVGFSSQTLDVHEHLRSFSQSEDIYK
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg323-Lys376
Aliases /Synonyms Solute carrier family 2 facilitated glucose transporter member 10, Glucose transporter type 10, GLUT-10, slc2a10
Reference ARO-P17893
Note For research use only.
Molecular Constructor
GST Arg323–Lys376 His
Product name ARO-P17893-1MG
Uniprot ID F1R0H0
Origin species Zebrafish
Expression system Prokaryotic expression
Raw Antigen Sequence RQSVIDTTKRCTSVGPHSNLTLSAEHDEGVGFSSQTLDVHEHLRSFSQSEDIYK
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg323-Lys376
Aliases /Synonyms Solute carrier family 2 facilitated glucose transporter member 10, Glucose transporter type 10, GLUT-10, slc2a10
Reference ARO-P17893
Note For research use only.
Molecular Constructor
GST Arg323–Lys376 His
Product name ARO-P17893-50
Uniprot ID F1R0H0
Origin species Zebrafish
Expression system Prokaryotic expression
Raw Antigen Sequence RQSVIDTTKRCTSVGPHSNLTLSAEHDEGVGFSSQTLDVHEHLRSFSQSEDIYK
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg323-Lys376
Aliases /Synonyms Solute carrier family 2 facilitated glucose transporter member 10, Glucose transporter type 10, GLUT-10, slc2a10
Reference ARO-P17893
Note For research use only.
Molecular Constructor
GST Arg323–Lys376 His

There are no reviews yet.

Be the first to review “Zebrafish slc2a10 Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products