Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Adiponectin(ADIPOQ)

  • PX-P4747-10
Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q6QWE7
Molecular weight:
17.4kDa

$250.00

+ 250 loyalty points
Ser105–Arg244
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Adiponectin(ADIPOQ)

Adiponectin(ADIPOQ)

Product name Adiponectin(ADIPOQ)
Uniprot ID Q6QWE7
Uniprot link https://www.uniprot.org/uniprot/Q6QWE7
Expression system Prokaryotic expression
Sequence MGESSYVYRSAFSVGLTERAPHPNVPIRFTKIFYNEQNHYDSSTGKFLCSIPGTYFFAYHLTVYMTDVKVSLYKKDKAVIFTYDQFQENNVDQASGSVLLHLSLGDEVWLQVYGEGNNNGVYADNINDSTFMGFLLYPDTDDRLEHHHHHH
Molecular weight 17.4kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser105-Arg244
Aliases /Synonyms Adiponectin,ADIPOQ
Reference PX-P4747
Note For research use only
Molecular Constructor
Ser105–Arg244
Product name Adiponectin(ADIPOQ)
Uniprot ID Q6QWE7
Uniprot link https://www.uniprot.org/uniprot/Q6QWE7
Expression system Prokaryotic expression
Sequence MGESSYVYRSAFSVGLTERAPHPNVPIRFTKIFYNEQNHYDSSTGKFLCSIPGTYFFAYHLTVYMTDVKVSLYKKDKAVIFTYDQFQENNVDQASGSVLLHLSLGDEVWLQVYGEGNNNGVYADNINDSTFMGFLLYPDTDDRLEHHHHHH
Molecular weight 17.4kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser105-Arg244
Aliases /Synonyms Adiponectin,ADIPOQ
Reference PX-P4747
Note For research use only
Molecular Constructor
Ser105–Arg244

There are no reviews yet.

Be the first to review “Adiponectin(ADIPOQ)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products