Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R recombinant protein

Host species:
Mammalian cells
Origin species:
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Uniprot ID:
P0CA64
Molecular weight:
41.38 kDa

Original price was: $428.00.Current price is: $330.00.

50ug 23% OFF + 330 loyalty points
Asn58–Lys161 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R  recombinant protein

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R recombinant protein

Product name PX-P6425-100
Uniprot ID P0CA64
Origin species African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Expression system Eukaryotic expression
Raw Antigen Sequence NQKDKTFYCPKDWVGYNNVCYYFGNDEKNYNNASNYCKQLNSTLTNNNTNLVNLTKTLNLTKTYNHESNYWVNYSLIKNESVLLRNSGYYKKQKHVSLLYICSK
Molecular weight 41.38 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn58-Lys161
Aliases /Synonyms pEP153R, Mal-065, African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)Lectin-like protein EP153R,
Reference PX-P6425
Molecular Constructor
Asn58–Lys161 Fc
Product name PX-P6425-1MG
Uniprot ID P0CA64
Origin species African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Expression system Eukaryotic expression
Raw Antigen Sequence NQKDKTFYCPKDWVGYNNVCYYFGNDEKNYNNASNYCKQLNSTLTNNNTNLVNLTKTLNLTKTYNHESNYWVNYSLIKNESVLLRNSGYYKKQKHVSLLYICSK
Molecular weight 41.38 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn58-Lys161
Aliases /Synonyms pEP153R, Mal-065, African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)Lectin-like protein EP153R,
Reference PX-P6425
Molecular Constructor
Asn58–Lys161 Fc
Product name PX-P6425-50
Uniprot ID P0CA64
Origin species African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Expression system Eukaryotic expression
Raw Antigen Sequence NQKDKTFYCPKDWVGYNNVCYYFGNDEKNYNNASNYCKQLNSTLTNNNTNLVNLTKTLNLTKTYNHESNYWVNYSLIKNESVLLRNSGYYKKQKHVSLLYICSK
Molecular weight 41.38 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn58-Lys161
Aliases /Synonyms pEP153R, Mal-065, African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)Lectin-like protein EP153R,
Reference PX-P6425
Molecular Constructor
Asn58–Lys161 Fc

African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R  recombinant protein

There are no reviews yet.

Be the first to review “African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV) ASFV EP153R recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products