Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein

Host species:
Mammalian cells
Origin species:
Porcine epidemic diarrhea virus (strain CV777) (PEDV)
Uniprot ID:
Q91AV1
Molecular weight:
16.79 kDa

Original price was: $376.00.Current price is: $330.00.

50ug 12% OFF + 330 loyalty points
Phe617–Val745 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein

Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein

Product name PX-P6508-100
Uniprot ID Q91AV1
Origin species Porcine epidemic diarrhea virus (strain CV777) (PEDV)
Expression system Eukaryotic expression
Raw Antigen Sequence FQFTKGELITGTPKPLEGITDVSFMTLDVCTKYTIYGFKGEGIITLTNSSILAGVYYTSDSGQLLAFKNVTSGAVYSVTPCSFSEQAAYVNDDIVGVISSLSNSTFNNTRELPGFFYHSNDGSNCTEPV
Molecular weight 16.79 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe617-Val745
Aliases /Synonyms S glycoprotein, E2, Peplomer protein, S, RBD, Porcine epidemic diarrhea virus (strain CV777) (PEDV)Spike glycoprotein,
Reference PX-P6508
Molecular Constructor
Phe617–Val745 His
Product name PX-P6508-1MG
Uniprot ID Q91AV1
Origin species Porcine epidemic diarrhea virus (strain CV777) (PEDV)
Expression system Eukaryotic expression
Raw Antigen Sequence FQFTKGELITGTPKPLEGITDVSFMTLDVCTKYTIYGFKGEGIITLTNSSILAGVYYTSDSGQLLAFKNVTSGAVYSVTPCSFSEQAAYVNDDIVGVISSLSNSTFNNTRELPGFFYHSNDGSNCTEPV
Molecular weight 16.79 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe617-Val745
Aliases /Synonyms S glycoprotein, E2, Peplomer protein, S, RBD, Porcine epidemic diarrhea virus (strain CV777) (PEDV)Spike glycoprotein,
Reference PX-P6508
Molecular Constructor
Phe617–Val745 His
Product name PX-P6508-50
Uniprot ID Q91AV1
Origin species Porcine epidemic diarrhea virus (strain CV777) (PEDV)
Expression system Eukaryotic expression
Raw Antigen Sequence FQFTKGELITGTPKPLEGITDVSFMTLDVCTKYTIYGFKGEGIITLTNSSILAGVYYTSDSGQLLAFKNVTSGAVYSVTPCSFSEQAAYVNDDIVGVISSLSNSTFNNTRELPGFFYHSNDGSNCTEPV
Molecular weight 16.79 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Phe617-Val745
Aliases /Synonyms S glycoprotein, E2, Peplomer protein, S, RBD, Porcine epidemic diarrhea virus (strain CV777) (PEDV)Spike glycoprotein,
Reference PX-P6508
Molecular Constructor
Phe617–Val745 His

SDS-PAGE for Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein

SDS-PAGE for Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein

Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products