Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-PEDV Spike glycoprotein (RBD) Polyclonal Antibody

  • ARO-A13444-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $196.00.Current price is: $140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-PEDV Spike glycoprotein (RBD) Polyclonal Antibody

Product name ARO-A13444-100
Uniprot ID Q91AV1
Raw Antigen Sequence FQFTKGELITGTPKPLEGITDVSFMTLDVCTKYTIYGFKGEGIITLTNSSILAGVYYTSDSGQLLAFKNVTSGAVYSVTPCSFSEQAAYVNDDIVGVISSLSNSTFNNTRELPGFFYHSNDGSNCTEPV
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Spike glycoprotein, S glycoprotein, E2, Peplomer protein, S
Reference ARO-A13444
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant PEDV Spike glycoprotein (RBD) (Phe617-Val745).
Product name ARO-A13444-1MG
Uniprot ID Q91AV1
Raw Antigen Sequence FQFTKGELITGTPKPLEGITDVSFMTLDVCTKYTIYGFKGEGIITLTNSSILAGVYYTSDSGQLLAFKNVTSGAVYSVTPCSFSEQAAYVNDDIVGVISSLSNSTFNNTRELPGFFYHSNDGSNCTEPV
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Spike glycoprotein, S glycoprotein, E2, Peplomer protein, S
Reference ARO-A13444
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant PEDV Spike glycoprotein (RBD) (Phe617-Val745).
Product name ARO-A13444-50
Uniprot ID Q91AV1
Raw Antigen Sequence FQFTKGELITGTPKPLEGITDVSFMTLDVCTKYTIYGFKGEGIITLTNSSILAGVYYTSDSGQLLAFKNVTSGAVYSVTPCSFSEQAAYVNDDIVGVISSLSNSTFNNTRELPGFFYHSNDGSNCTEPV
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Spike glycoprotein, S glycoprotein, E2, Peplomer protein, S
Reference ARO-A13444
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant PEDV Spike glycoprotein (RBD) (Phe617-Val745).

Anti-PEDV Spike glycoprotein (RBD) Polyclonal Antibody binds to Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein in WB Assay

Anti-PEDV Spike glycoprotein (RBD) Polyclonal Antibody binds to Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD)  recombinant protein in WB Assay

Porcine epidemic diarrhea virus (strain CV777) (PEDV) PEDV Spike glycoprotein (RBD) recombinant protein(cat. No.PX-P6509) can bind Anti-PEDV Spike glycoprotein (RBD) Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Anti-PEDV Spike glycoprotein (RBD) Polyclonal Antibody

There are no reviews yet.

Be the first to review “Anti-PEDV Spike glycoprotein (RBD) Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products