Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Clonality:
Monoclonal Antibody
Isotype:
VHH-8His-Cys-tag

$451.00

100ug + 451 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Product name Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)
Uniprot ID P09386
Raw Antigen Sequence MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-stxB2, Anti-SLT-2b, Anti-VT2
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Protein Name stxB2

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

SDS-PAGE for Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products