Brand: ProteoGenix

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

ARO-A18716
Quality Chart

Clonality:: Monoclonal Antibody
Isotype:: VHH-8His-Cys-tag

$451.00

100ug + 451 loyalty points

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Product name	Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)
Uniprot ID	P09386
Raw Antigen Sequence	MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Aliases /Synonyms	Anti-stxB2, Anti-SLT-2b, Anti-VT2
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Protein Name	stxB2

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

Datasheet

SDS-PAGE for Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

SDS-PAGE for Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Specifications Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Description

Documents

QC & Validation

SDS-PAGE for Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Bacteriophage 933W stxB2/SLT-2b/VT2 VHH (Nb113)