Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Bet v 1/Allergen Bet v I-A Antibody (SAA0665)

Original price was: $427.00.Current price is: $324.00.

50ug 24% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Bet v 1/Allergen Bet v I-A Antibody (SAA0665)

Product name ARO-A14769-100
Uniprot ID P15494
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Betula pendula (European white birch) (Betula verrucosa)
Reference ARO-A14769
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BETVIA, BETVI, Major pollen allergen Bet v 1-A, Allergen Bet v 1-A, REGN5715
Target species Anti-Betula pendula (European white birch) (Betula verrucosa) Monoclonal Antibody
Product name ARO-A14769-1MG
Uniprot ID P15494
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Betula pendula (European white birch) (Betula verrucosa)
Reference ARO-A14769
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BETVIA, BETVI, Major pollen allergen Bet v 1-A, Allergen Bet v 1-A, REGN5715
Target species Anti-Betula pendula (European white birch) (Betula verrucosa) Monoclonal Antibody
Product name ARO-A14769-50
Uniprot ID P15494
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Betula pendula (European white birch) (Betula verrucosa)
Reference ARO-A14769
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen BETVIA, BETVI, Major pollen allergen Bet v 1-A, Allergen Bet v 1-A, REGN5715
Target species Anti-Betula pendula (European white birch) (Betula verrucosa) Monoclonal Antibody

SDS-PAGE for Anti-Bet v 1/Allergen Bet v I-A Antibody (SAA0665)

SDS-PAGE for Anti-Bet v 1/Allergen Bet v I-A Antibody (SAA0665)

Anti-Bet v 1/Allergen Bet v I-A Antibody (SAA0665), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Bet v 1/Allergen Bet v I-A Antibody (SAA0665)

There are no reviews yet.

Be the first to review “Anti-Bet v 1/Allergen Bet v I-A Antibody (SAA0665)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products