Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Atisnolerbart Biosimilar – Anti-BETVIA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Product name Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2045
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2045
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA2045-50
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2045
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Title: Introducing Atisnolerbart Biosimilar – Anti-BETVIA mAb: A Revolutionary Antibody for Therapeutic Targeting

Introduction

Atisnolerbart Biosimilar – Anti-BETVIA mAb is a groundbreaking monoclonal antibody (mAb) that has been specifically designed to target and neutralize the BETVIA protein. This biosimilar is a highly potent and effective therapeutic agent that has the potential to revolutionize the treatment of various diseases and disorders.

Structure of Atisnolerbart Biosimilar – Anti-BETVIA mAb

Atisnolerbart Biosimilar – Anti-BETVIA mAb is a recombinant, humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has been engineered to have a high binding affinity and specificity towards the BETVIA protein.

Activity of Atisnolerbart Biosimilar – Anti-BETVIA mAb

The primary function of Atisnolerbart Biosimilar – Anti-BETVIA mAb is to bind to the BETVIA protein and inhibit its activity. The BETVIA protein is a key regulator of inflammation and is involved in various pathological processes, making it an attractive therapeutic target. By binding to BETVIA, Atisnolerbart Biosimilar – Anti-BETVIA mAb effectively blocks its activity, leading to a reduction in inflammation and associated symptoms.

Application of Atisnolerbart Biosimilar – Anti-BETVIA mAb

Atisnolerbart Biosimilar – Anti-BETVIA mAb has a wide range of potential applications in the treatment of various diseases and disorders. Some of the key therapeutic areas where this biosimilar can be used include:

1. Inflammatory Diseases: The primary application of Atisnolerbart Biosimilar – Anti-BETVIA mAb is in the treatment of inflammatory diseases such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. By targeting BETVIA, this biosimilar can effectively reduce inflammation and provide relief from associated symptoms.

2. Autoimmune Diseases: Autoimmune diseases are characterized by an overactive immune system that attacks healthy cells and tissues. Atisnolerbart Biosimilar – Anti-BETVIA mAb can be used to treat autoimmune diseases such as lupus, multiple sclerosis, and type 1 diabetes by modulating the immune response and reducing inflammation.

3.

Cancer: The BETVIA protein has been found to play a role in the development and progression of certain cancers. Atisnolerbart Biosimilar – Anti-BETVIA mAb can be used as an adjuvant therapy in cancer treatment by targeting BETVIA and inhibiting its activity, thereby reducing tumor growth and metastasis.

4.

Infectious Diseases: In addition to its anti-inflammatory properties, Atisnolerbart Biosimilar – Anti-BETVIA mAb has also shown potential in treating infectious diseases. By targeting BETVIA, this biosimilar can modulate the immune response and enhance the body’s ability to fight off infections.

Conclusion

Atisnolerbart Biosimilar – Anti-BETVIA mAb is a highly promising therapeutic agent that has the potential to revolutionize the treatment of various diseases and disorders. Its unique structure, high specificity, and potent activity make it a valuable tool for targeting the BETVIA protein and modulating inflammatory processes. With its wide range of potential applications, this biosimilar is set to make a significant impact in the field of medicine.

SDS-PAGE for Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

SDS-PAGE for Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Atisnolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

There are no reviews yet.

Be the first to review “Atisnolerbart Biosimilar – Anti-BETVIA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products