Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody

  • ARO-A13443-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $195.00.Current price is: $140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody

Product name ARO-A13443-100
Uniprot ID AGC12054.1
Raw Antigen Sequence CDAKPVVKGKFNTTLLNGPAFQMVCPMGWTGSVDCVLANKDTLKVVVVRTYKRARPFPNRQGCVTQKLLGEDLYDCTHGGNWTCIAGEQLHYTGGDIESCKWCGHKFLKSEGLPHYPIGKCRLKNETGYRLVDDTSCNRDGVAIVQHGTMKCRIGDTVVQVIAMDNKLGPMPCKPYEITPSEGPVEKTACTFNYTKTLRNKYFEPRDNYFQQYMLKGD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-A13443
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant BVDV (Mucosal disease virus) E2 glycoprotein (Cys1-Asp218).
Product name ARO-A13443-1MG
Uniprot ID AGC12054.1
Raw Antigen Sequence CDAKPVVKGKFNTTLLNGPAFQMVCPMGWTGSVDCVLANKDTLKVVVVRTYKRARPFPNRQGCVTQKLLGEDLYDCTHGGNWTCIAGEQLHYTGGDIESCKWCGHKFLKSEGLPHYPIGKCRLKNETGYRLVDDTSCNRDGVAIVQHGTMKCRIGDTVVQVIAMDNKLGPMPCKPYEITPSEGPVEKTACTFNYTKTLRNKYFEPRDNYFQQYMLKGD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-A13443
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant BVDV (Mucosal disease virus) E2 glycoprotein (Cys1-Asp218).
Product name ARO-A13443-50
Uniprot ID AGC12054.1
Raw Antigen Sequence CDAKPVVKGKFNTTLLNGPAFQMVCPMGWTGSVDCVLANKDTLKVVVVRTYKRARPFPNRQGCVTQKLLGEDLYDCTHGGNWTCIAGEQLHYTGGDIESCKWCGHKFLKSEGLPHYPIGKCRLKNETGYRLVDDTSCNRDGVAIVQHGTMKCRIGDTVVQVIAMDNKLGPMPCKPYEITPSEGPVEKTACTFNYTKTLRNKYFEPRDNYFQQYMLKGD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-A13443
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant BVDV (Mucosal disease virus) E2 glycoprotein (Cys1-Asp218).

Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody

There are no reviews yet.

Be the first to review “Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products