Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-DENV-3 Protein prM/prM Polyclonal Antibody

  • ARO-A12782-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: $194.00.Current price is: $140.00.

50ug 28% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-DENV-3 Protein prM/prM Polyclonal Antibody binds to Recombinant DENV-3 Protein prM/prM Protein, N-GST & C-His in WB Assay

Anti-DENV-3 Protein prM/prM Polyclonal Antibody

Product name ARO-A12782-100
Uniprot ID P27915
Raw Antigen Sequence GEPRMIVGKNERGKSLLFKTASGINMCTLIAMDLGEMCDDTVTYKCPHITEVEPEDIDCWCNLTSTWVTYGTCNQAGEHRRDKR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-A12782
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant DENV-3 Protein prM/prM (Gly122-Arg205).
Product name ARO-A12782-1MG
Uniprot ID P27915
Raw Antigen Sequence GEPRMIVGKNERGKSLLFKTASGINMCTLIAMDLGEMCDDTVTYKCPHITEVEPEDIDCWCNLTSTWVTYGTCNQAGEHRRDKR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-A12782
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant DENV-3 Protein prM/prM (Gly122-Arg205).
Product name ARO-A12782-50
Uniprot ID P27915
Raw Antigen Sequence GEPRMIVGKNERGKSLLFKTASGINMCTLIAMDLGEMCDDTVTYKCPHITEVEPEDIDCWCNLTSTWVTYGTCNQAGEHRRDKR
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-A12782
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant DENV-3 Protein prM/prM (Gly122-Arg205).

Anti-DENV-3 Protein prM/prM Polyclonal Antibody binds to Recombinant DENV-3 Protein prM/prM Protein, N-GST & C-His in WB Assay

Anti-DENV-3 Protein prM/prM Polyclonal Antibody binds to Recombinant DENV-3 Protein prM/prM Protein, N-GST & C-His in WB Assay

Recombinant DENV-3 Protein prM/prM Protein, N-GST & C-His(cat. No.ARO-P10881) can bind Anti-DENV-3 Protein prM/prM Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-DENV-3 Protein prM/prM Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products