Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Calpurbatug Biosimilar – Anti-DNA-binding protein HU-alpha mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $228.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade

Product name Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade
Uniprot ID P0ACF0 & P0ACF4 & P0A6X7 & P0A6Y1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-DNA-binding protein HU-alpha, HU-2, NS2, hupA, b4000, JW3964, DNA-binding protein HU-beta, HU-1, NS1, hupB, hopD, b0440, JW0430, Integration host factor subunit alpha, IHF-alpha, ihfA, hid, himA, b1712, JW1702, Integration host factor subunit beta, IHF-beta, ihfB, himD, hip, b0912, JW0895
Reference PX-TA2054
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade
Uniprot ID P0ACF0 & P0ACF4 & P0A6X7 & P0A6Y1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-DNA-binding protein HU-alpha, HU-2, NS2, hupA, b4000, JW3964, DNA-binding protein HU-beta, HU-1, NS1, hupB, hopD, b0440, JW0430, Integration host factor subunit alpha, IHF-alpha, ihfA, hid, himA, b1712, JW1702, Integration host factor subunit beta, IHF-beta, ihfB, himD, hip, b0912, JW0895
Reference PX-TA2054
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2054-50
Uniprot ID P0ACF0 & P0ACF4 & P0A6X7 & P0A6Y1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-DNA-binding protein HU-alpha, HU-2, NS2, hupA, b4000, JW3964, DNA-binding protein HU-beta, HU-1, NS1, hupB, hopD, b0440, JW0430, Integration host factor subunit alpha, IHF-alpha, ihfA, hid, himA, b1712, JW1702, Integration host factor subunit beta, IHF-beta, ihfB, himD, hip, b0912, JW0895
Reference PX-TA2054
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Calpurbatug Biosimilar is a monoclonal antibody (mAb) that specifically targets the DNA-binding protein HU-alpha. This biosimilar is designed to mimic the structure and function of the original therapeutic antibody, providing researchers with a high-quality tool for studying the role of HU-alpha in various biological processes.

Structure of Calpurbatug Biosimilar

Calpurbatug Biosimilar is a fully humanized mAb, meaning that it is derived from human cells and has minimal risk of immune reactions. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the target protein, while the constant regions provide stability and effector functions.

Activity of Calpurbatug Biosimilar

The primary function of Calpurbatug Biosimilar is to bind to HU-alpha, a highly conserved DNA-binding protein found in all living organisms. HU-alpha plays a crucial role in DNA replication, transcription, and repair, making it an important therapeutic target for various diseases. By binding to HU-alpha, Calpurbatug Biosimilar can modulate its activity and potentially inhibit its function, providing researchers with a valuable tool for studying the role of HU-alpha in different biological processes.

Application of Calpurbatug Biosimilar

Calpurbatug Biosimilar has a wide range of applications in both basic research and drug development. In basic research, it can be used to study the function of HU-alpha in various biological processes, such as DNA replication, transcription, and repair. It can also be used to investigate the role of HU-alpha in disease states, such as cancer and autoimmune disorders.

In drug development, Calpurbatug Biosimilar can serve as a potential therapeutic for diseases that involve dysregulation of HU-alpha. For example, it can be used to target HU-alpha in cancer cells, potentially inhibiting their growth and proliferation. Additionally, Calpurbatug Biosimilar can be used as a tool in drug discovery, helping to identify and validate potential drug targets related to HU-alpha.

Research Grade of Calpurbatug Biosimilar

Calpurbatug Biosimilar is available in a research grade, making it suitable for use in laboratory experiments and pre-clinical studies. It is produced using advanced biotechnology techniques, ensuring high purity and consistency. The research grade also allows for customization, such as conjugation with fluorescent dyes or other molecules, to suit specific research needs.

Conclusion

In summary, Calpurbatug Biosimilar is a highly specific and potent mAb that targets the DNA-binding protein HU-alpha. Its structure, activity, and application make it a valuable tool for studying the role of HU-alpha in various biological processes and as a potential therapeutic for diseases involving HU-alpha dysregulation. Its research grade availability also makes it a versatile tool for research and drug development.

SDS-PAGE for Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade

SDS-PAGE for Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade

Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade

There are no reviews yet.

Be the first to review “Calpurbatug Biosimilar – Anti-DNA-binding protein HU-alpha mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products