Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Humax-Il15 Biosimilar – Anti-IL15 mAb – Research Grade

  • PX-TA1131-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Humax-Il15 Biosimilar - Anti-IL15 mAb - Research Grade

Product name Humax-Il15 Biosimilar - Anti-IL15 mAb - Research Grade
Uniprot ID P40933
Species Homo sapiens
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Humax-Il15,AMG 714,HuMax-IL15,IL15,anti-IL15
Reference PX-TA1131
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Humax-Il15 Biosimilar - Anti-IL15 mAb - Research Grade
Uniprot ID P40933
Species Homo sapiens
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Humax-Il15,AMG 714,HuMax-IL15,IL15,anti-IL15
Reference PX-TA1131
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1131-50
Uniprot ID P40933
Species Homo sapiens
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Humax-Il15,AMG 714,HuMax-IL15,IL15,anti-IL15
Reference PX-TA1131
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Humax-Il15 Biosimilar is a novel therapeutic antibody that has been developed as a biosimilar to the existing anti-IL15 monoclonal antibody (mAb) therapies. This biosimilar has been designed to specifically target and inhibit the activity of interleukin-15 (IL-15), a cytokine that plays a crucial role in the regulation of immune responses. In this article, we will discuss the structure, activity, and potential applications of Humax-Il15 Biosimilar in the field of immunotherapy.

Structure of Humax-Il15 Biosimilar

Humax-Il15 Biosimilar is a recombinant humanized monoclonal antibody that has been produced using advanced genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc) region. The Fab regions are responsible for binding to the target IL-15 molecule, while the Fc region is involved in effector functions such as complement activation and antibody-dependent cellular cytotoxicity (ADCC).

Activity of Humax-Il15 Biosimilar

The primary function of Humax-Il15 Biosimilar is to bind to IL-15 and inhibit its activity. IL-15 is a pro-inflammatory cytokine that is produced by various cells of the immune system, including dendritic cells, macrophages, and T cells. It plays a crucial role in the proliferation and survival of T cells, natural killer (NK) cells, and B cells. However, dysregulation of IL-15 has been linked to the development of autoimmune diseases, chronic inflammation, and cancer. By binding to IL-15, Humax-Il15 Biosimilar prevents its interaction with its receptors and inhibits downstream signaling pathways, thus reducing the inflammatory response.

Applications of Humax-Il15 Biosimilar

Humax-Il15 Biosimilar has potential applications in the treatment of various diseases that are associated with dysregulated IL-15 activity. One of the main therapeutic targets for this biosimilar is rheumatoid arthritis (RA). IL-15 has been shown to play a crucial role in the pathogenesis of RA by promoting the production of pro-inflammatory cytokines and the activation of immune cells. By inhibiting IL-15, Humax-Il15 Biosimilar can help reduce inflammation and joint damage in patients with RA.

Another potential application of Humax-Il15 Biosimilar is in the treatment of inflammatory bowel disease (IBD). IL-15 has been implicated in the development of IBD, and its inhibition has shown promising results in preclinical studies. Humax-Il15 Biosimilar could potentially be used as a targeted therapy for IBD, with fewer side effects compared to conventional treatments.

In addition to these, Humax-Il15 Biosimilar may also have a role in the treatment of certain types of cancer. IL-15 has been shown to enhance the anti-tumor activity of NK cells and T cells, and its inhibition may help in controlling the growth and spread of cancer cells. Clinical trials are currently underway to evaluate the efficacy of Humax-Il15 Biosimilar in the treatment of various cancers, including melanoma and multiple myeloma.

Conclusion

Humax-Il15 Biosimilar is a promising therapeutic antibody that has been designed to target and inhibit the activity of IL-15. Its unique structure and mechanism of action make it a potential treatment option for a wide range of diseases, including RA, IBD, and cancer. With ongoing research and clinical trials, Humax-Il15 Biosimilar has the potential to improve the lives of patients suffering from these debilitating conditions.

SEC-HPLC of HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade

SEC-HPLC of HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade

HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade

SDS-PAGE for HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade

HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Humax-Il15 Biosimilar - Anti-IL15 mAb - Research Grade

There are no reviews yet.

Be the first to review “Humax-Il15 Biosimilar – Anti-IL15 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products