Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Trevogrumab Biosimilar – Anti-MSTN, GDF8 mAb – Research Grade

  • PX-TA1388-50
  • Validated ELISA WB
Isotype:
IgG4, Kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

Product name Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade
Uniprot ID O14793
Source CAS 1429201-24-0
Species Homo sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Trevogrumab,REGN-1033, REGN1033, SAR-391786,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1388
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade
Uniprot ID O14793
Source CAS 1429201-24-0
Species Homo sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Trevogrumab,REGN-1033, REGN1033, SAR-391786,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1388
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1388-50
Uniprot ID O14793
Source CAS 1429201-24-0
Species Homo sapiens
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Trevogrumab,REGN-1033, REGN1033, SAR-391786,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1388
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa

General information on Anti-MSTN/GDF8[Homo sapiens] (Trevogrumab) Monoclonal Antibody

Trevogrumab has been investigated for the treatment of Orthopedic disease and Sarcopenia.

SDS-PAGE for Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb

SDS-PAGE for Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb

Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Trevogrumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade

SEC-HPLC of Trevogrumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade

Trevogrumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

There are no reviews yet.

Be the first to review “Trevogrumab Biosimilar – Anti-MSTN, GDF8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products