Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fletikumab Biosimilar – Anti-IL20 mAb – Research Grade

  • PX-TA1336-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fletikumab Biosimilar - Anti-IL20 mAb - Research Grade

Product name Fletikumab Biosimilar - Anti-IL20 mAb - Research Grade
Uniprot ID Q9NYY1
Source CAS 1357158-22-5
Species Homo sapiens
Raw Antigen Sequence MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Fletikumab,15D2,NN-8226,NNC-0109-0012,IL20 ,anti-IL20
Reference PX-TA1336
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Fletikumab Biosimilar - Anti-IL20 mAb - Research Grade
Uniprot ID Q9NYY1
Source CAS 1357158-22-5
Species Homo sapiens
Raw Antigen Sequence MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Fletikumab,15D2,NN-8226,NNC-0109-0012,IL20 ,anti-IL20
Reference PX-TA1336
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1336-50
Uniprot ID Q9NYY1
Source CAS 1357158-22-5
Species Homo sapiens
Raw Antigen Sequence MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Fletikumab,15D2,NN-8226,NNC-0109-0012,IL20 ,anti-IL20
Reference PX-TA1336
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

General information on Anti-IL20 [Homo sapiens] (Fletikumab) Monoclonal Antibody

Fletikumab is investigated for the treatment of Rheumatoid Arthritis.

SEC-HPLC of Fletikumab Biosimilar - Anti-IL20 mAb - Research Grade

SEC-HPLC of Fletikumab Biosimilar - Anti-IL20  mAb - Research Grade

Fletikumab Biosimilar - Anti-IL20 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Fletikumab Biosimilar - Anti-IL20 mAb - Research Grade

SDS-PAGE for Fletikumab Biosimilar - Anti-IL20  mAb - Research Grade

Fletikumab Biosimilar - Anti-IL20 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Fletikumab Biosimilar - Anti-IL20  mAb - Research Grade

There are no reviews yet.

Be the first to review “Fletikumab Biosimilar – Anti-IL20 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products