Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-CD235a/GYPA Polyclonal Antibody

  • PTX20638-50
  • Validated WB

Original price was: $177.00.Current price is: $140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-CD235a/GYPA Polyclonal Antibody

Product name PTX20638-100
Uniprot ID P02724
Raw Antigen Sequence SALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 ℃ for one week. Store at -20 ℃ for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD235a, GYPA, GPA, Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD235a/GYPA
Format Liquid
Product name PTX20638-1MG
Uniprot ID P02724
Raw Antigen Sequence SALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 ℃ for one week. Store at -20 ℃ for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD235a, GYPA, GPA, Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD235a/GYPA
Format Liquid
Product name PTX20638-50
Uniprot ID P02724
Raw Antigen Sequence SALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEP
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at 2 to 8 ℃ for one week. Store at -20 ℃ for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD235a, GYPA, GPA, Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD235a/GYPA
Format Liquid

There are no reviews yet.

Be the first to review “Anti-CD235a/GYPA Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products