Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-CD333/FGFR3 Polyclonal Antibody

  • PTX20078-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $193.00.Current price is: $140.00.

50ug 27% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-CD333/FGFR3 Polyclonal Antibody binds to Human CD333/FGFR3 Recombinant Protein, C-Fc in WB Assay

Anti-CD333/FGFR3 Polyclonal Antibody

Product name PTX20078-100
Uniprot ID P22607
Raw Antigen Sequence VPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD333, Anti-FGFR3, Anti-FGFR-3
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human,Mouse,Rat
Product name PTX20078-1MG
Uniprot ID P22607
Raw Antigen Sequence VPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD333, Anti-FGFR3, Anti-FGFR-3
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human,Mouse,Rat
Product name PTX20078-50
Uniprot ID P22607
Raw Antigen Sequence VPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-CD333, Anti-FGFR3, Anti-FGFR-3
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human,Mouse,Rat

Anti-CD333/FGFR3 Polyclonal Antibody binds to Human CD333/FGFR3 Recombinant Protein, C-Fc in WB Assay

Anti-CD333/FGFR3 Polyclonal Antibody binds to Human CD333/FGFR3 Recombinant Protein, C-Fc in WB Assay

Human CD333/FGFR3 Recombinant Protein, C-Fc(cat. No.ARO-P18201) can bind Anti-CD333/FGFR3 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-CD333/FGFR3 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products