Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Dog IL31 Monoclonal Antibody (ABS0678)

  • PTX25858-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $413.00.Current price is: $315.00.

50ug 24% OFF + 315 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Dog IL31 Monoclonal Antibody (ABS0678)

Product name PTX25858-100
Uniprot ID C7G0W1
Raw Antigen Sequence MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-Lokivetmab, Anti-IL31, Anti-Interleukin-31, CAN34D3-65, PF-06443537, CAS: 1533403-95-0
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Protein Name Lokivetmab
Product name PTX25858-1MG
Uniprot ID C7G0W1
Raw Antigen Sequence MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-Lokivetmab, Anti-IL31, Anti-Interleukin-31, CAN34D3-65, PF-06443537, CAS: 1533403-95-0
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Protein Name Lokivetmab
Product name PTX25858-50
Uniprot ID C7G0W1
Raw Antigen Sequence MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-Lokivetmab, Anti-IL31, Anti-Interleukin-31, CAN34D3-65, PF-06443537, CAS: 1533403-95-0
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Protein Name Lokivetmab

SDS-PAGE for Anti-Dog IL31 Monoclonal Antibody (ABS0678)

SDS-PAGE for Anti-Dog IL31 Monoclonal Antibody (ABS0678)

Anti-Dog IL31 Monoclonal Antibody (ABS0678), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Anti-Dog IL31 Monoclonal Antibody (ABS0678)

SEC-HPLC of Anti-Dog IL31 Monoclonal Antibody (ABS0678)

Anti-Dog IL31 Monoclonal Antibody (ABS0678) was analyzed by size exclusion chromatography with UV detection.

There are no reviews yet.

Be the first to review “Anti-Dog IL31 Monoclonal Antibody (ABS0678)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products