Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD9 (AT14-012)

  • PTX25682-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $394.00.Current price is: $315.00.

50ug 20% OFF + 315 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD9 (AT14-012)

Product name PTX25682-100
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CD9, Anti-MRP-1, Anti-MIC3, AT14-012, AT14 012, AT14012
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name CD9
Product name PTX25682-1MG
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CD9, Anti-MRP-1, Anti-MIC3, AT14-012, AT14 012, AT14012
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name CD9
Product name PTX25682-50
Uniprot ID P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CD9, Anti-MRP-1, Anti-MIC3, AT14-012, AT14 012, AT14012
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Protein Name CD9

Flow Cytometry results for Anti-Human CD9 (AT14-012)

Flow Cytometry results for Anti-Human CD9 (AT14-012)

Flow-cytometry using PE anti-human CD9 antibody. HCT-116 cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD9 monoclonal antibody (Catalog PTX25682, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Anti-Human CD9 (AT14-012)

Flow Cytometry results for Anti-Human CD9 (AT14-012)

Flow-cytometry using APC anti-human CD9 antibody. HCT-116 cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD9 monoclonal antibody (Catalog PTX25682, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human CD9 (AT14-012)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products