Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662)

  • ARO-A18920-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
VHH-hFc

Original price was: $438.00.Current price is: $315.00.

50ug 28% OFF + 315 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662)

Product name ARO-A18920-100
Uniprot ID P03205
Raw Antigen Sequence MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-GP42, Anti-Glycoprotein 42
Isotype VHH-hFc
Clonality Monoclonal Antibody
Protein Name GP42
Product name ARO-A18920-1MG
Uniprot ID P03205
Raw Antigen Sequence MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-GP42, Anti-Glycoprotein 42
Isotype VHH-hFc
Clonality Monoclonal Antibody
Protein Name GP42
Product name ARO-A18920-50
Uniprot ID P03205
Raw Antigen Sequence MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-GP42, Anti-Glycoprotein 42
Isotype VHH-hFc
Clonality Monoclonal Antibody
Protein Name GP42

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662) binds to Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His in ELISA Assay

Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662) binds to Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His in ELISA Assay

Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His(cat. No.ARO-P15674) at 0.5µg/mL (100µL/well) can bind Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Anti-EBV/HHV-4 GP42/Glycoprotein 42 Antibody (ABS0662)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products