Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His

Host species:
Mammalian cells
Origin species:
Epstein-Barr virus (EBV/HHV-4)
Uniprot ID:
P03205
Molecular weight:
25 kDa

Original price was: $447.00.Current price is: $350.00.

50ug 22% OFF + 350 loyalty points
Arg30–Ser223 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His

Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His

Product name ARO-P15674-100
Uniprot ID P03205
Origin species Epstein-Barr virus (EBV/HHV-4)
Expression system Eukaryotic expression
Raw Antigen Sequence RVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Molecular weight 25 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg30-Ser223
Aliases /Synonyms Glycoprotein 42, gp42, Soluble gp42, BZLF2
Reference ARO-P15674
Note For research use only.
Molecular Constructor
Arg30–Ser223 His
Product name ARO-P15674-1MG
Uniprot ID P03205
Origin species Epstein-Barr virus (EBV/HHV-4)
Expression system Eukaryotic expression
Raw Antigen Sequence RVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Molecular weight 25 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg30-Ser223
Aliases /Synonyms Glycoprotein 42, gp42, Soluble gp42, BZLF2
Reference ARO-P15674
Note For research use only.
Molecular Constructor
Arg30–Ser223 His
Product name ARO-P15674-50
Uniprot ID P03205
Origin species Epstein-Barr virus (EBV/HHV-4)
Expression system Eukaryotic expression
Raw Antigen Sequence RVRGGGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Molecular weight 25 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg30-Ser223
Aliases /Synonyms Glycoprotein 42, gp42, Soluble gp42, BZLF2
Reference ARO-P15674
Note For research use only.
Molecular Constructor
Arg30–Ser223 His

SDS-PAGE for Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His

SDS-PAGE for Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His

Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant EBV/HHV4 GP42/Glycoprotein 42 Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products