Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-FN1 Polyclonal antibody

  • ARO-A14240-100
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $280.00.Current price is: $201.00.

100ug 28% OFF + 201 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-FN1 Polyclonal antibody binds to Mouse FN1 Recombinant Protein, N-His in WB Assay
Anti-FN1 Polyclonal antibody

Anti-FN1 Polyclonal antibody

Product name ARO-A14240-100
Uniprot ID P02751
Raw Antigen Sequence GVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cold-insoluble globulin,CIG,FN,Fibronectin,FN1,
Reference ARO-A14240
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human FN1 (Gly313-Ser607).
Product name ARO-A14240-1MG
Uniprot ID P02751
Raw Antigen Sequence GVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cold-insoluble globulin,CIG,FN,Fibronectin,FN1,
Reference ARO-A14240
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human FN1 (Gly313-Ser607).
Product name ARO-A14240-50
Uniprot ID P02751
Raw Antigen Sequence GVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPS
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Cold-insoluble globulin,CIG,FN,Fibronectin,FN1,
Reference ARO-A14240
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human FN1 (Gly313-Ser607).

Anti-FN1 Polyclonal antibody binds to Mouse FN1 Recombinant Protein, N-His in WB Assay

Anti-FN1 Polyclonal antibody binds to Mouse FN1 Recombinant Protein, N-His in WB Assay

Mouse FN1 Recombinant Protein, N-His(cat. No.ARO-P18890) can bind Anti-FN1 Polyclonal antibody in Western Blot Assay as detected on gel analysis.

Anti-FN1 Polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-FN1 Polyclonal antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products