Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

  • ARO-A14929-50
  • Validated ELISA

Original price was: $450.00.Current price is: $324.00.

50ug 28% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

Product name ARO-A14929-100
Uniprot ID P03172
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)
Reference ARO-A14929
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Envelope glycoprotein D, gD, gD, US6, Human herpes simplex virus 2 (HSV-2), Human herpesvirus 2 (strain 333), Human herpes simplex virus 2, HHV-2
Target species Anti-Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2) Monoclonal Antibody
Product name ARO-A14929-1MG
Uniprot ID P03172
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)
Reference ARO-A14929
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Envelope glycoprotein D, gD, gD, US6, Human herpes simplex virus 2 (HSV-2), Human herpesvirus 2 (strain 333), Human herpes simplex virus 2, HHV-2
Target species Anti-Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2) Monoclonal Antibody
Product name ARO-A14929-50
Uniprot ID P03172
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)
Reference ARO-A14929
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Envelope glycoprotein D, gD, gD, US6, Human herpes simplex virus 2 (HSV-2), Human herpesvirus 2 (strain 333), Human herpes simplex virus 2, HHV-2
Target species Anti-Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2) Monoclonal Antibody

SDS-PAGE for Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

SDS-PAGE for Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365) binds to Recombinant HSV-2 gD/US6, N-GST in ELISA Assay

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365) binds to Recombinant HSV-2 gD/US6, N-GST in ELISA Assay

Recombinant HSV-2 gD/US6, N-GST(cat. No.ARO-P12850) at 0.5µg/mL (100µL/well) can bind Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)

There are no reviews yet.

Be the first to review “Anti-HSV-2/HHV-2 gD/Envelope glycoprotein D Antibody (SAA0365)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products