Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant HSV-2 gD/US6, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
HHV-2
Uniprot ID:
P03172
Molecular weight:
61.21 kDa

Original price was: $486.00.Current price is: $392.00.

100ug 19% OFF + 392 loyalty points
Lys26–Pro339
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant HSV-2 gD/US6, N-GST

Recombinant HSV-2 gD/US6, N-GST

Product name ARO-P12850-100
Uniprot ID P03172
Origin species HHV-2
Expression system Prokaryotic expression
Raw Antigen Sequence KYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNP
Molecular weight 61.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys26-Pro339
Aliases /Synonyms Envelope glycoprotein D, gD, US6,Human,Herpes simplex virus type 2 (HSV-2),Human herpesvirus 2 (strain 333) (HHV-2)
Reference ARO-P12850
Note For research use only.
Molecular Constructor
Lys26–Pro339
Product name ARO-P12850-1MG
Uniprot ID P03172
Origin species HHV-2
Expression system Prokaryotic expression
Raw Antigen Sequence KYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNP
Molecular weight 61.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys26-Pro339
Aliases /Synonyms Envelope glycoprotein D, gD, US6,Human,Herpes simplex virus type 2 (HSV-2),Human herpesvirus 2 (strain 333) (HHV-2)
Reference ARO-P12850
Note For research use only.
Molecular Constructor
Lys26–Pro339
Product name ARO-P12850-50
Uniprot ID P03172
Origin species HHV-2
Expression system Prokaryotic expression
Raw Antigen Sequence KYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNP
Molecular weight 61.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys26-Pro339
Aliases /Synonyms Envelope glycoprotein D, gD, US6,Human,Herpes simplex virus type 2 (HSV-2),Human herpesvirus 2 (strain 333) (HHV-2)
Reference ARO-P12850
Note For research use only.
Molecular Constructor
Lys26–Pro339

Recombinant HSV-2 gD/US6, N-GST

There are no reviews yet.

Be the first to review “Recombinant HSV-2 gD/US6, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products