Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human AREG Antibody (ABS1537)

  • ARO-A17499-100
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: $600.00.Current price is: $451.00.

100ug 25% OFF + 451 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human AREG Antibody (ABS1537)

Product name ARO-A17499-100
Uniprot ID P15514
Raw Antigen Sequence MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-AREG
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name AREG
Product name ARO-A17499-1MG
Uniprot ID P15514
Raw Antigen Sequence MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-AREG
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name AREG
Product name ARO-A17499-50
Uniprot ID P15514
Raw Antigen Sequence MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-AREG
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Protein Name AREG

Anti-Human AREG Antibody (ABS1537) binds to Human AREG Recombinant Protein, N-GST & C-His in ELISA Assay

Anti-Human AREG Antibody (ABS1537) binds to Human AREG Recombinant Protein, N-GST & C-His in ELISA Assay

Human AREG Recombinant Protein, N-GST & C-His(cat. No.ARO-P19069) at 0.5µg/mL (100µL/well) can bind Anti-Human AREG Antibody (ABS1537) in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human AREG Antibody (ABS1537) binds to Human AREG Recombinant Protein, N-GST & C-His in WB Assay

Anti-Human AREG Antibody (ABS1537) binds to Human AREG Recombinant Protein, N-GST & C-His in WB Assay

Human AREG Recombinant Protein, N-GST & C-His(cat. No.ARO-P19069) can bind Anti-Human AREG Antibody (ABS1537) in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human AREG Antibody (ABS1537)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products